3KDPABH

Crystal structure of the sodium-potassium pump
Link type Probability Chain A piercings Chain B piercings Chain H piercings
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
view details
Unlink Unlink 52% -846H +864H -982H +1016H
Interpreting sequences
Chain A Sequence
AKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIQAATEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWSDNQIHEADTTENQSGVSFDKTSATWLALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYTKIVEIPFNSTNKYQLSIHKNPNTAEPRHLLVMKGAPERILDRCSSILIHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPLDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPASKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNEQLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVNWDDRWINDVEDSYGQQWTYEQRKIVEFTCHTPFFVTIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY
Chain A Sequence
NSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQSQKTEISFRPNDPQSYESYVVSIVRFLEKYKDLAQKDDMIFEDCGNVPSELKERGEYNNERGERKVCRSRLEWLGNCSGLNDETYGYKDGKPCVIIKLNRVLGFKPKPPKNESLETYPVMKYNPYVLPVHCTGKRDEDKEKVGTMEYFGLGGYPGFPLQYYPYYGKLLQPKYLQPLMAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Chain A Sequence
YETVRNGGLIFAALAFIVGLIILLSKR
sequence length 998,286,27
structure length 998,286,27
publication title Crystal structure of the sodium-potassium pump.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Sodium/potassium-transporting ATPase subunit alpha-1
ec nomenclature ec 3.6.3.9: Sodium/potassium-exchanging ATPase.
pdb deposition date2009-10-23
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABH PF00122 E1-E2_ATPaseE1-E2 ATPase
ABH PF00689 Cation_ATPase_CCation transporting ATPase, C-terminus
ABH PF00690 Cation_ATPase_NCation transporter/ATPase, N-terminus
ABH PF13246 Cation_ATPaseCation transport ATPase (P-type)
ABH PF00287 Na_K-ATPaseSodium / potassium ATPase beta chain
ABH PF02038 ATP1G1_PLM_MAT8ATP1G1/PLM/MAT8 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1110.10 Mainly Alpha Up-down Bundle Calcium-transporting ATPase, transmembrane domain Calcium-transporting ATPase, transmembrane domain 3kdpA02
2.70.150.10 Mainly Beta Distorted Sandwich Calcium-transporting ATPase, cytoplasmic transduction domain A Calcium-transporting ATPase, cytoplasmic transduction domain A 3kdpA01
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3kdpA03
3.40.1110.10 Alpha Beta 3-Layer(aba) Sandwich Calcium-transporting ATPase, cytoplasmic domain N Calcium-transporting ATPase, cytoplasmic domain N 3kdpA04
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 3kdpB02
3KDPACD 3KDPABG 1CR6AB 1EK2AB 3KDPABH 3KDPBCG 3KDPABD 1EK1AB 3KDPACG 3KDPCDG 3KDPCDH 1CQZAB 3KDPCD 3KDPAB 3KDPBCH 3KDPABC
chains in the LinkProt database with same CATH superfamily
3ETDCEF 3HPJBDE 3ETGBDE 3HWXAB 3IXABDF 1XCBACEF 1XCBADEF 1OM3HKLM 3H4FABC 3E2HABQ 1ZLWHLM 3KDPABC 1MV8AC 3N2LABCD 2AMFCD 3DXAKM 2AHRBCD 3H3FEGH 3ETDCD 3DXADE 3DX7AC 2AMFABC 3HWX1S 1XCBABEF 3DXAACD 3GDGAC 3HWXIJ 3JTTADE 1XCBABDF 3HWXABZ 3HWXBSZ 2AHRACE 3GSUAP 1AGBAC 3FFCACG 3H9HACE 3N2LEFH 3IXAAB 3E3QHJK 3DXAEIJ 3N2LDGH 3N2LCEF 1A97BD 3DXAFG 3H9SCD 3FB6AB 1A9BAC 2AHRABCE 1ZLVKM 1XCBBDEG 2AMFACD 3GJFDF 1E0JBCDE 3GJEAHL 1XCBBE 1AIFHL 3DXAABC 3H3FABF 3HWXIS 3HAEJKM 3E3Qde 1MUUBD 1ZLUHKM 1MV8CD 3H4HBC 3HAEABC 1ZLWKLM 3ETDADF 3E3QADQ 3HAEDFG 3E3QBFG 1AGBABC 1XCBBCEG 3JWNCGK 3DSFHL 1NQBAC 1ZLUHM 3FQRAC 3N2LCDEH 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FCSBC 1O5OCD 3FMGHL 1ZXKAB 3HPLAB 1SLVAB 3GMDBFG 3N2LACF 3FFCFH 1AGEAC 3JWNFIK 3GSVABP 3N2LEH 3F7OAB 1Q8MABCD 3N2LADEH 1AHWDE 1E0JABCF 3HAEPQR 3HPJDE 3H9HBDF 1ZLWHK 3GSUAB 3ETGAD 3GSOAP 3HNSHL 3GIVADE 1E0JBC 2AMFADE 3ETGBCF 1XCBABG 3HAENO 3E3QPRT 2AMFAD 3DXAKMO 3HAEACL 3KDPACG 3GVPACD 1MV8BCD 3H9SACE 3N2LAB 3H3FEFG 3H3FBCD 3GMDCDH 3JWNHLM 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 3HWX1BJ 1XCBAE 1EK1AB 1A1NABC 3EFFAN 1MV8BD 3ETDBE 3ETGCDF 3JTTDE 3JTTDEI 3JTTAEI 1O5OBD 1MUUAB 1XCBABFG 3H7BDEF 1E0JAB 1ZLUKLM 2AMFABCD 3ETGABE 1A97ACD 3H3FBFG 2IF0AB 3HAEACG 1UT1CF 1CR6AB 2ZEJAB 3DXAFH 3HWX1BR 3E3QCF 1ATIAB 3HWXAZ 3HAEDFP 3JWNGMN 3HPJDEF 3HNVHL 1GMEAB 3N2LGH 3JWNIKN 3H4FBC 1OP3HM 3EYWAB 3GJFDEH 2BI4AB 3HWXBIS 3JWNFGN 3HGMABC 3DXAACJ 3N2LACFG 3JTTDFH 3HWX1RZ 1O5OBC 3FT3ABP 3FQNAC 1A9BBDF 1K75AB 1OP3HKL 3FFCABC 1E0JDEF 1XCBCD 3HWXJSZ 3FONACP 3JTTDG 1A9BDEF 1OP5LM 3EFFBM 3N2LAE 3H9HDF 3HWXAS 1A9EAB 1AHWAF 3HPJAB 1XCBBDE 2AMFABDE 1OP3KM 3JTTCDG 3FFCAB 3HWXBJZ 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 3ETDABD 1ZLWLM 1XCBBG 3N2LEG 3H3FABD 3N2LACEG 2VSCCD 3JTTACI 1EK2AB 3N2LACDF 2AHRDE 3EFDKL 1A9BABC 2AHRAB 3HAEDFI 3FQXAB 3GJFAC 1E0JBF 1Q8MAB 3H3FCDF 3FFCDE 3GEFAB 3H4HAB 3H7BAB 3FT3AP 3GEFACD 3N2LABDG 3DXAAC 3N2LDEGH 3JTTADG 1XCBACDF 1ZLWHL 3HAELN 3HLAAB 3HWXAIJ 1XCBBEF 3HWXSZ 1A1MAC 3E3QeF 1XCBADF 3KDPCDG 3HWXBJS 3GSNHL 1AFVKM 3N2LBCF 2AMFAE 3E3QRS 1XCBCEG 3H7BDE 3H7BABD 1ZLVLM 2AHRBD 3FQWAC 3HAEGT 3IVKBH 3E3QUVX 1ZLUHK 3E3QDHK 1A97ABD 3GDGBCD 3HWXBI 3DX9ACD 3HAEACP 3GSWAB 3H5AAD 3HWXIJZ 3N2LEFGH 3H9SAC 3N2LCD 2AMFAB 1UT1BCF 1MUUBCD 3DXAKLM 3N2LABEG 3GDGBD 3HGMAD 3FFCBFH 3N2LDEF 3HWXAIS 3KDPABD 2AHRAE 3JWNHIL 2W5PAB 1O5OABC 3ETDBDE 3GMDBFH 3HWXASZ 1ZLVHL 3HWXBIZ 3HWX1AB 1E0JBCE 1XCBAG 1OP5HKM 1XCBCDEG 2AMFABD 3N2LADEG 3JTTCDI 1MFZAB 3ETDCDF 3FB5AB 3GIVADF 1A9BAB 3GEFBCD 3FOLABP 1XCBABDE 2AMFBCDE 3N2LABD 3N2LCEFG 3H5AAC 1E0JBCF 3N2LACE 3HAEPQ 3ETGBCE 3GSVAP 1ZLUKM 3GMDBEF 1XCBAEF 3GSNAHP 1OM3HLM 3N2LCDF 3HWXAJR 1AGCAB 3GIVDF 3JTTAEG 3FFCACE 3DO6AB 3GEFAC 3ETDBEF 3HAEAB 1OP5HM 3JWNIKL 3FB7AB 3DX6AB 3H5AACD 3H9HDEF 1ZLWHKLM 3HG1ACE 3DXAACH 3H4FAC 3K5SAB 3DXAIJ 3HWX1JR 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3N2LBCDG 3JWNGH 3EFDHL 3DX7ABC 2AHRBDE 3JTTCGH 1ZLVHKM 3N2LDEH 3N2LDEFH 3JTTAB 3N2LBC 1E0JCF 1OP3LM 1UT1ADE 3GIVABD 1E0JDE 3FQUAB 1XCBAB 3GMDBDF 1OP5HL 1MUUABD 3HWX1BZ 3GSNAB 3JWNHMN 3FRUABC 3ETDABF 3ETDDE 3HAEGJK 1A8JHL 3FFCCFH 1XCBDEF 3HWX1RS 1XCBCDF 3HAEIK 3ETDBCF 1UT1BC 1XCBBCDE 3JTTEFH 3JTTDEG 1A97ABC 3N2LAD 3ETGCEF 2VSCBCD 1O5OBCD 1ZLVKLM 3DXAJKM 1A1NAB 3N2LDEFG 3FOMAP 3GB7AB 3FT3AB 3DZDAB 3HWXAJ 3GEFAD 3H9HABC 3IXADF 3FOMAB 3FCSAB 3H7BADF 3H9HAC 1Q8MABD 3N2LCDEG 1MUUABC 3HAEJMN 3ETDACE 3GSOABP 3JTTBDE 3N2LBCD 3GSQAB 3JTTAGI 3DXAFHI 3JWNEHK 3FQTAB 3H7BACE 3FQRABC 3DX6AC 2AMFCDE 3N2LACEH 3N2LAEH 2AHRCDE 1MV8ABD 1Q8MCD 1AGDABC 3DX8ABC 3HCVAB 1A1MABC 1XCBACG 1Q8MAD 3N2LCEFH 3JWNCFL 3F7OABX 3E3QAEQ 1ZLWHKM 3N2LCF 3N2LBCFG 1XCBACE 3HAEACH 1OM3HKM 3HAEJM 3N2LDFG 3FFCACI 3HGMAB 3FT2AP 3H5ABD 1CDCAB 3E2HACQ 3ETGABD 3N2LCDFG 1XCBABCE 3N2LABCE 1XCBCDFG 3FFCFG 1WWAXY 3JTTEG 3HWXBIJ 3H3FGH 3H9SABC 3JTTAEF 3HWXISZ 3EFFAM 3JTTCEG 1E0JBDEF 3GDGAB 3GIVAD 1OP5HKL 1A9EABC 3GMDADH 3HPJABC 3ECABCD 3JWNCEH 3FONCD 2AHRACD 3IXADEF 3HWXIJS 3H3FAFG 3DXACKM 1XCBCG 3DXAAKM 3GVPBD 3FFCACD 3GDGAD 3HWXAIZ 3GSNHLP 1ZLSHL 3JWNHN 2AMFBDE 3GJFEH 3GEFCD 3ECAACD 3GDGACD 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FCSBCD 3JWNIKM 3FQNABC 3GEFABC 2AMFACE 3GJFDE 1A9BADF 3HAEDEF 1GMECD 3GJFACL 3H9HAD 3IXAADE 3HWX1IZ 3DXAFGH 2AHRABC 3E3QMN 1AIFAB 3GJFDEF 3GJFDFK 3N2LBCDE 1XCBBCEF 3JWNCGH 3GIVACD 3GJFAB 1ZLUHL 3HGMBD 3EYUHL 3GMDABF 3N2LAEGH 1E0JCD 1XCBACFG 3N2LFG 3HAEDFK 1LSSAB 1E0JCEF 1MV8ABCD 3N2LDEG 3HWX1AR 3HWXARZ 3IVKAH 2AHRBCDE 3JWNEHN 1AGFAC 3HAEPRT 3JWNCEM 1E0JABCE 3HWXABS 1LSSCD 1XCBBCDG 2AHRABD 3EOTHL 1OP5HLM 1O5OAB 3HAEDFM 1A97AD 1A9BACF 3FQTAC 3FCSCD 3HAEDF 3EFFCK 1MFZCD 1XCBABF 1XCBDE 3JWNCGI 3ETDAD 3ETGADE 2AMFACDE 3JTTGH 3FRUACD 3KDPACD 3IVKHL 3HAEHLO 3N2LADE 3FOLAB 1OP5KLM 3HWX1BS 1A97AC 3JTTBDG 1OM3KL 1E0JCDF 1O5OACD 1E0JBEF 3HWX1BI 1MUUACD 3GSWABP 3GEFBD 1UT1BF 3JTTAFH 1E0JBCD 3HWXABJ 1AGCABC 1ZVNAB 2AMFBD 3FCSABD 1AQKHL 1OM3KLM 3E3QHIK 3HWXAJZ 1MUUAC 1XCBCEFG 3GSRABP 3DXANO 3N2LDG 3DX6ABC 3EFFCD 1XCBACEG 3E3QUWX 3F7VAB 1ZLVHLM 3FQWABC 2VSCACD 1XCBADEG 1W5FAB 3HAEJK 1ZLUHLM 3JWNGN 1MV8AB 3HAEAJM 1AGDAB 3ETGABF 2W5PABC 1XCBABCG 3HAEHL 3DXAKL 3H5AABD 3FFCFGH 3GEFABD 3N2LEGH 3JWNIK 1ZLULM 3HWXBIR 1XCBABEG 3GSRAP 3HGMABD 3N2LDFGH 3H9HADE 3JTTDFG 3HPJDF 3HWXBRS 3H3FACD 3GJEBL 2AMFABCE 3JTTABC 2VSCABC 1XCBCE 1E0JABEF 3JWNCEL 2AHRABDE 3H9HACD 3DXAACK 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 3H3FEFH 3GK8HL 3HG1AB 3F7YAB 3GJEBHL 1OP3HLM 1E0JABF 2AHRABCD 3GIVAC 1XCBBDEF 3HAEST 1CQZAB 1OM3HK 1E0JEF 3HAEACJ 2VSCBC 3IXAABE 3DXAACL 3N2LEF 3HWXIRS 3HWX1A 3GMDBCF 3N2LACEF 3EFFBN 3H7BACD 3JTTACH 1AIFAHL 3N2LACDG 1AGFABC 3E3QDE 2IEYAB 3JWNGHM 1AIFAL 3FQXAC 3ETDBCE 3N2LDE 3GMDBF 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 3GMDDH 1A9BCDF 3HWXAI 1XCBACDE 3GIVABC 3H4HABC 3HAELO 3N2LABEH 3GJFHL 3GSXABP 3GMDDFH 3GVPCD 2AHRACDE 1LSUAB 3JWNHLN 3N2LCDGH 1AGEAB 1XCBADFG 3HWX1AJ 3GSRAB 3JTTBFH 3HWXIRZ 3E3QBCG 3JWNCEK 3FQWAB 3GIZHL 3FT4AB 3HAEDE 2AMFBC 3FONCDE 3H9SACD 1O5OAD 3FFCDFH 1A9BACD 3GJEABL 3H9SAB 3F7OBY 3ETDAF 2AMFAC 3JWNCEN 3FFCACJ 3FT4AP 3FFCACF 1ZLWHM 3GDGABC 3GJFKM 2VSCABCD 3KDPABG 2AHRAD 3JWNHIK 1AGBAB 3N2LAC 3GSUABP 3HWXARS 1ZLVHM 3FONAB 3HWX1JZ 3HWXRSZ 3FRUEF 1OP3HK 3N2LCFGH 3GSNBHP 3HPJADE 1XCBCDEF 3ETDBF 3HWX1IJ 3ETDCDE 3GSXAB 2VSCAC 3HG1ACD 3GVPBCD 3FOMABP 3N2LABE 3N2LACD 3HAEPR 3FQNAB 3GSQABP 1XCBAEG 3GDGABD 3N2LCDG 1AGCAC 3N2LABDE 3FONABP 1MUUCD 3HGMBCD 3DX8AC 3HFMHL 2AMFDE 3HC3HL 3JWNGHI 1OP3HL 1OM3HKL 3GJFABC 1A9EAC 3H3FEF 3JTTDF 3JTTDFI 3H4FAB 3JWNMN 3EFFDK 3KDPAB 3E3Qcdf 3JWNLMN 1ZLUHKL 3GMDDEH 3N2LBCDF 3GSVAB 3FRUAB 3EFDHK 1O5OABCD 3EFFCL 3HPJAD 1A97AB 3GJEAB 3H9HAB 3KDPCD 3GJEHL 3HWXAR 1A97BC 1A64AB 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 3DXAFHJ 3ETGCF 1OP3KLM 1OM3HM 3N2LADFG 1A97BCD 1ZLWKM 1KAHAB 1E0JBCDF 3ETDABE 3IXAABC 3HWXRZ 3FCSAD 3GJFACH 3HAELNO 1XCBCDE 3H7BACF 3HGMCD 3HWXBRZ 3N2LACDE 1MV8ACD 3ETDADE 3FQUAC 3HPJACD 3HWXBS 3FRUBCD 2AMFBCD 3FCSACD 3JWNCGL 1XCBAEFG 3H4HAC 2W5PBC 2BL4AB 1XCBDF 3H9HADF 3ETDAC 3IXAADF 1OP3HKM 3DXAAB 3JTTADF 1XCBACDG 1E0JBCEF 3ETGAEF 3FT2ABP 1XCBBEG 3GMDBDH 1A1MAB 2AHRAC 1XCBEF 3JWNEFH 3HWXBJR 3N2LAEFH 1XCBBCE 3FCTAB 3JTTAGH 3ETGACF 1XCBCEF 3DL2AB 2AHRADE 3GEFBC 3EFFAB 2AHRBC 3H3FFGH 3IXADE 3HG1ABC 1MV8ABC 3HCVAC 3HWXBJ 1A9BDE 3HGMACD 3DX7AB 3N2LCDEF 3F7OABY 3DX9CD 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 3GJEABH 3N2LABEF 3GDGBC 1OP5HKLM 1OP5KM 3GMDCD 3HWXAIR 3E3QPST 3N2LEFG 3JWNHIM 1O5OABD 3FFCAC 3N2LABCF 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3FCSABC 3FOLAP 1XCBAF 3GJEAH 3N2LADG 2AMFABE 3N2LADEF 3DX9AB 3FT2AB 3DXAACF 3KDPBCH 3ETGBF 3ETGBE 3IVKABL 1ZLUHKLM 3HWX1IR 3N2LABC 1A9BDF 3JWNCE 3HWXIJR 1UT1DE 1UT1AD 3H3FBEF 1MUUABCD 3GSWAP 3IXAAD 3IVKBL 3IXAABD 3JWNFHL 3N2LCDE 3HWXAJS 3FB8AB 3GIVDE 1AHWAB 3HAEAC 1E0JCDEF 1E0JABC 3H9SDE 3KDPCDH 3HWX1AZ 1Q8MACD 3DXADEI 3N2LFGH 3FONCE 2VSCBD 1A1OABC 1XCBBEFG 1ZLVHKLM 3GIVAB 2W5PAC 3N2LAEG 3FFCIJ 3GJFDFM 3HWX1JS 1X7DAB 3GJEBH 3JTTAD 3FONACE 1UT1AE 3JTTGI 3N2LAEFG 1AGEABC 1KARAB 1ZLVHKL 1XCBAFG 3JTTAC 1QEXAB 1E0JCE 3HAEJMO 3GDGCD 3ETDACF 3EFFAK 3GSOAB 3FRUAD 3GMDDGH 3JTTDGH 3KDPBCG 3HPJACE 3HAEGI 3N2LADGH 3JTTCDF 3HWX1AI 1AGFAB 3GIVDEF 3JWNCFN 3HWX1SZ 1XCBCDG 1E0JABCD 3HWXABR 1Q8MBC 2AHRABE 3JTTDEF 1O5OAC 1OP5HK 3HAEDFL 3JWNCGN 3ETGBCD 1A1OAB 3N2LBCEF 1XCBABE 1A1NAC 3ETGADF 3N2LCFG 3JWNGIK 3E3QIJ 3E3QVW 2VSCABD 3N2LAEF 3FCSAC 3H7BDF 3KDPABH 1XCBADE 3ETGDE 3ETDACD 3FQUABC 3JTTBDF 1XCBBCG 3FRUABD 1OM3KM 3IVKAB 1E0JCDE 3ETGACD 3DXADKM 3DXAEFH 3H7BABC 3HWXRS 3DXADJ 3HWX1Z 3JWNCEG 3EYSHL 3HWXABI 1KAEAB 1AGDAC 3DX8AB 3DXAEJ 3HWXJRS 3HCVABC 3JWNCFM 2AHRCD 1Q8MABC
chains in the LinkProt database with same CATH topology
3N2LFG 3HWXAB 3N2LEFH 3N2LABD 3KDPAB 1A97ABD 3HWXBI 3HWX1AR 3N2LGH 3HWXIJZ 3N2LEFGH 3N2LBCDF 1O5OABCD 3HWX1S 1A97AB 3KDPCD 3HWXAIS 3HWXABS 1A97BC 3KDPABD 3HWX1JR 3HWXBSZ 1O5OAB 3HWXASZ 3N2LCFG 3N2LADE 3N2LADFG 1A97BCD 3HWX1AB 3HWXAS 3N2LADEG 3HWXRZ 3N2LDGH 1A97BD 3KDPACD 3N2LCEF 3HWXBRZ 3EYWAB 3N2LDE 3HWX1BS 1A97AC 3N2LCEFG 3HWXBS 3N2LACE 3HWX1IJ 1O5OACD 3HWX1BI 3KDPABC 2BL4AB 3N2LAE 3N2LAEF 3N2LCDF 3HWXABJ 3N2LDFG 3HWXIRZ 3N2LEH 3HWXBJR 3N2LBCFG 3N2LDG 3N2LBCDG 3ECABCD 3N2LABDE 3N2LCDEH 1W5FAB 3HWXABZ 1A97AD 3HWXBJ 3N2LABE 3N2LEF 3HWXARZ 3F7OABY 3N2LACF 3N2LCDE 3N2LEGH 3HWXAJS 3N2LDEH 3HWXBIR 3N2LADEH 3N2LBC 3N2LABEF 3HWXAIR 3F7OAB 3HWXBRS 3N2LABCF 3HWX1BZ 3N2LEFG 3N2LADG 3N2LDFGH 3N2LADEF 3HWX1RS 3KDPBCH 3GVPACD 3HWXAR 3HWX1IR 3N2LAB 1A97ABC 3N2LAD 3HWXIJR 1O5OBCD 3HWX1BJ 1CQZAB 1EK1AB 3N2LDEFG 3HWXAJR 3N2LAEG 3DZDAB 3HWXIRS 3HWX1A 3N2LACEF 3N2LABEG 1O5OCD 1O5OBD 3N2LCDEG 3KDPCDH 3HWX1AZ 3N2LFGH 1O5OABD 1A97ACD 3N2LABDG 3N2LBCD 1CR6AB 3N2LACEH 3N2LAEH 3HWXAI 3N2LDEF 3HWX1JS 3GVPCD 3N2LAEGH 3N2LAEFG 3HWXAJ 3N2LCEFH 3HWXIJ 3F7OABX 3N2LCD 3N2LCDGH 3N2LACDE 3N2LCF 3HWX1AJ 2BI4AB 3N2LCDG 3HWXBIS 3HWXAJZ 3N2LACFG 3HWX1RZ 1O5OBC 3HWXJRS 1O5OAD 3N2LAEFH 3N2LCDFG 3N2LABCE 3N2LDEFH 3HWXBIJ 3HWXJSZ 3N2LABCD 3N2LADGH 3F7OBY 3HWX1AI 3HWXISZ 3HWXAIJ 3HWX1SZ 3N2LDEG 3HWXABR 3KDPABG 3N2LAC 1O5OAC 3HWXARS 3HWXBJZ 3HWX1JZ 3HWXRSZ 3N2LBCEF 3GVPBD 3N2LCFGH 3HWXBIZ 3N2LACDG 3N2LEG 3HWXAIZ 3N2LACEG 1EK2AB 3N2LACDF 3KDPABH 3N2LCDEF 3GVPBCD 3HWX1BR 3ECAACD 3N2LABC 3N2LACD 1O5OABC 3HWXRS 3HWXIS 3HWX1Z 3N2LDEGH 3N2LABEH 3HWXABI 3KDPBCG 3HWXAZ 3HWX1IZ 3KDPACG 3HWXSZ 3KDPCDG 3HWXBJS 3N2LBCF 3HWXIJS 3N2LBCDE
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3KDP ACD;  3KDP ABG;  1CR6 AB;  1EK2 AB;  3KDP ABH;  3KDP BCG;  3KDP ABD;  1EK1 AB;  3KDP ACG;  3KDP CDG;  3KDP CDH;  1CQZ AB;  3KDP CD;  3KDP AB;  3KDP BCH;  3KDP ABC; 
#chains in the LinkProt database with same CATH topology
 3ETD CEF;  3HPJ BDE;  3ETG BDE;  3HWX AB;  3IXA BDF;  1XCB ACEF;  1XCB ADEF;  1OM3 HKLM;  3H4F ABC;  3E2H ABQ;  1ZLW HLM;  3KDP ABC;  1MV8 AC;  3N2L ABCD;  2AMF CD;  3DXA KM;  2AHR BCD;  3H3F EGH;  3ETD CD;  3DXA DE;  3DX7 AC;  2AMF ABC;  3HWX 1S;  1XCB ABEF;  3DXA ACD;  3GDG AC;  3HWX IJ;  3JTT ADE;  1XCB ABDF;  3HWX ABZ;  3HWX BSZ;  2AHR ACE;  3GSU AP;  1AGB AC;  3FFC ACG;  3H9H ACE;  3N2L EFH;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3N2L DGH;  3N2L CEF;  1A97 BD;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  2AHR ABCE;  1ZLV KM;  1XCB BDEG;  2AMF ACD;  3GJF DF;  1E0J BCDE;  3GJE AHL;  1XCB BE;  1AIF HL;  3DXA ABC;  3H3F ABF;  3HWX IS;  3HAE JKM;  3E3Q de;  1MUU BD;  1ZLU HKM;  1MV8 CD;  3H4H BC;  3HAE ABC;  1ZLW KLM;  3ETD ADF;  3E3Q ADQ;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  1XCB BCEG;  3JWN CGK;  3DSF HL;  1NQB AC;  1ZLU HM;  3FQR AC;  3N2L CDEH;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FCS BC;  1O5O CD;  3FMG HL;  1ZXK AB;  3HPL AB;  1SLV AB;  3GMD BFG;  3N2L ACF;  3FFC FH;  1AGE AC;  3JWN FIK;  3GSV ABP;  3N2L EH;  3F7O AB;  1Q8M ABCD;  3N2L ADEH;  1AHW DE;  1E0J ABCF;  3HAE PQR;  3HPJ DE;  3H9H BDF;  1ZLW HK;  3GSU AB;  3ETG AD;  3GSO AP;  3HNS HL;  3GIV ADE;  1E0J BC;  2AMF ADE;  3ETG BCF;  1XCB ABG;  3HAE NO;  3E3Q PRT;  2AMF AD;  3DXA KMO;  3HAE ACL;  3KDP ACG;  3GVP ACD;  1MV8 BCD;  3H9S ACE;  3N2L AB;  3H3F EFG;  3H3F BCD;  3GMD CDH;  3JWN HLM;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  3HWX 1BJ;  1XCB AE;  1EK1 AB;  1A1N ABC;  3EFF AN;  1MV8 BD;  3ETD BE;  3ETG CDF;  3JTT DE;  3JTT DEI;  3JTT AEI;  1O5O BD;  1MUU AB;  1XCB ABFG;  3H7B DEF;  1E0J AB;  1ZLU KLM;  2AMF ABCD;  3ETG ABE;  1A97 ACD;  3H3F BFG;  2IF0 AB;  3HAE ACG;  1UT1 CF;  1CR6 AB;  2ZEJ AB;  3DXA FH;  3HWX 1BR;  3E3Q CF;  1ATI AB;  3HWX AZ;  3HAE DFP;  3JWN GMN;  3HPJ DEF;  3HNV HL;  1GME AB;  3N2L GH;  3JWN IKN;  3H4F BC;  1OP3 HM;  3EYW AB;  3GJF DEH;  2BI4 AB;  3HWX BIS;  3JWN FGN;  3HGM ABC;  3DXA ACJ;  3N2L ACFG;  3JTT DFH;  3HWX 1RZ;  1O5O BC;  3FT3 ABP;  3FQN AC;  1A9B BDF;  1K75 AB;  1OP3 HKL;  3FFC ABC;  1E0J DEF;  1XCB CD;  3HWX JSZ;  3FON ACP;  3JTT DG;  1A9B DEF;  1OP5 LM;  3EFF BM;  3N2L AE;  3H9H DF;  3HWX AS;  1A9E AB;  1AHW AF;  3HPJ AB;  1XCB BDE;  2AMF ABDE;  1OP3 KM;  3JTT CDG;  3FFC AB;  3HWX BJZ;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  3ETD ABD;  1ZLW LM;  1XCB BG;  3N2L EG;  3H3F ABD;  3N2L ACEG;  2VSC CD;  3JTT ACI;  1EK2 AB;  3N2L ACDF;  2AHR DE;  3EFD KL;  1A9B ABC;  2AHR AB;  3HAE DFI;  3FQX AB;  3GJF AC;  1E0J BF;  1Q8M AB;  3H3F CDF;  3FFC DE;  3GEF AB;  3H4H AB;  3H7B AB;  3FT3 AP;  3GEF ACD;  3N2L ABDG;  3DXA AC;  3N2L DEGH;  3JTT ADG;  1XCB ACDF;  1ZLW HL;  3HAE LN;  3HLA AB;  3HWX AIJ;  1XCB BEF;  3HWX SZ;  1A1M AC;  3E3Q eF;  1XCB ADF;  3KDP CDG;  3HWX BJS;  3GSN HL;  1AFV KM;  3N2L BCF;  2AMF AE;  3E3Q RS;  1XCB CEG;  3H7B DE;  3H7B ABD;  1ZLV LM;  2AHR BD;  3FQW AC;  3HAE GT;  3IVK BH;  3E3Q UVX;  1ZLU HK;  3E3Q DHK;  1A97 ABD;  3GDG BCD;  3HWX BI;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3H5A AD;  3HWX IJZ;  3N2L EFGH;  3H9S AC;  3N2L CD;  2AMF AB;  1UT1 BCF;  1MUU BCD;  3DXA KLM;  3N2L ABEG;  3GDG BD;  3HGM AD;  3FFC BFH;  3N2L DEF;  3HWX AIS;  3KDP ABD;  2AHR AE;  3JWN HIL;  2W5P AB;  1O5O ABC;  3ETD BDE;  3GMD BFH;  3HWX ASZ;  1ZLV HL;  3HWX BIZ;  3HWX 1AB;  1E0J BCE;  1XCB AG;  1OP5 HKM;  1XCB CDEG;  2AMF ABD;  3N2L ADEG;  3JTT CDI;  1MFZ AB;  3ETD CDF;  3FB5 AB;  3GIV ADF;  1A9B AB;  3GEF BCD;  3FOL ABP;  1XCB ABDE;  2AMF BCDE;  3N2L ABD;  3N2L CEFG;  3H5A AC;  1E0J BCF;  3N2L ACE;  3HAE PQ;  3ETG BCE;  3GSV AP;  1ZLU KM;  3GMD BEF;  1XCB AEF;  3GSN AHP;  1OM3 HLM;  3N2L CDF;  3HWX AJR;  1AGC AB;  3GIV DF;  3JTT AEG;  3FFC ACE;  3DO6 AB;  3GEF AC;  3ETD BEF;  3HAE AB;  1OP5 HM;  3JWN IKL;  3FB7 AB;  3DX6 AB;  3H5A ACD;  3H9H DEF;  1ZLW HKLM;  3HG1 ACE;  3DXA ACH;  3H4F AC;  3K5S AB;  3DXA IJ;  3HWX 1JR;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3N2L BCDG;  3JWN GH;  3EFD HL;  3DX7 ABC;  2AHR BDE;  3JTT CGH;  1ZLV HKM;  3N2L DEH;  3N2L DEFH;  3JTT AB;  3N2L BC;  1E0J CF;  1OP3 LM;  1UT1 ADE;  3GIV ABD;  1E0J DE;  3FQU AB;  1XCB AB;  3GMD BDF;  1OP5 HL;  1MUU ABD;  3HWX 1BZ;  3GSN AB;  3JWN HMN;  3FRU ABC;  3ETD ABF;  3ETD DE;  3HAE GJK;  1A8J HL;  3FFC CFH;  1XCB DEF;  3HWX 1RS;  1XCB CDF;  3HAE IK;  3ETD BCF;  1UT1 BC;  1XCB BCDE;  3JTT EFH;  3JTT DEG;  1A97 ABC;  3N2L AD;  3ETG CEF;  2VSC BCD;  1O5O BCD;  1ZLV KLM;  3DXA JKM;  1A1N AB;  3N2L DEFG;  3FOM AP;  3GB7 AB;  3FT3 AB;  3DZD AB;  3HWX AJ;  3GEF AD;  3H9H ABC;  3IXA DF;  3FOM AB;  3FCS AB;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3N2L CDEG;  1MUU ABC;  3HAE JMN;  3ETD ACE;  3GSO ABP;  3JTT BDE;  3N2L BCD;  3GSQ AB;  3JTT AGI;  3DXA FHI;  3JWN EHK;  3FQT AB;  3H7B ACE;  3FQR ABC;  3DX6 AC;  2AMF CDE;  3N2L ACEH;  3N2L AEH;  2AHR CDE;  1MV8 ABD;  1Q8M CD;  1AGD ABC;  3DX8 ABC;  3HCV AB;  1A1M ABC;  1XCB ACG;  1Q8M AD;  3N2L CEFH;  3JWN CFL;  3F7O ABX;  3E3Q AEQ;  1ZLW HKM;  3N2L CF;  3N2L BCFG;  1XCB ACE;  3HAE ACH;  1OM3 HKM;  3HAE JM;  3N2L DFG;  3FFC ACI;  3HGM AB;  3FT2 AP;  3H5A BD;  1CDC AB;  3E2H ACQ;  3ETG ABD;  3N2L CDFG;  1XCB ABCE;  3N2L ABCE;  1XCB CDFG;  3FFC FG;  1WWA XY;  3JTT EG;  3HWX BIJ;  3H3F GH;  3H9S ABC;  3JTT AEF;  3HWX ISZ;  3EFF AM;  3JTT CEG;  1E0J BDEF;  3GDG AB;  3GIV AD;  1OP5 HKL;  1A9E ABC;  3GMD ADH;  3HPJ ABC;  3ECA BCD;  3JWN CEH;  3FON CD;  2AHR ACD;  3IXA DEF;  3HWX IJS;  3H3F AFG;  3DXA CKM;  1XCB CG;  3DXA AKM;  3GVP BD;  3FFC ACD;  3GDG AD;  3HWX AIZ;  3GSN HLP;  1ZLS HL;  3JWN HN;  2AMF BDE;  3GJF EH;  3GEF CD;  3ECA ACD;  3GDG ACD;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FCS BCD;  3JWN IKM;  3FQN ABC;  3GEF ABC;  2AMF ACE;  3GJF DE;  1A9B ADF;  3HAE DEF;  1GME CD;  3GJF ACL;  3H9H AD;  3IXA ADE;  3HWX 1IZ;  3DXA FGH;  2AHR ABC;  3E3Q MN;  1AIF AB;  3GJF DEF;  3GJF DFK;  3N2L BCDE;  1XCB BCEF;  3JWN CGH;  3GIV ACD;  3GJF AB;  1ZLU HL;  3HGM BD;  3EYU HL;  3GMD ABF;  3N2L AEGH;  1E0J CD;  1XCB ACFG;  3N2L FG;  3HAE DFK;  1LSS AB;  1E0J CEF;  1MV8 ABCD;  3N2L DEG;  3HWX 1AR;  3HWX ARZ;  3IVK AH;  2AHR BCDE;  3JWN EHN;  1AGF AC;  3HAE PRT;  3JWN CEM;  1E0J ABCE;  3HWX ABS;  1LSS CD;  1XCB BCDG;  2AHR ABD;  3EOT HL;  1OP5 HLM;  1O5O AB;  3HAE DFM;  1A97 AD;  1A9B ACF;  3FQT AC;  3FCS CD;  3HAE DF;  3EFF CK;  1MFZ CD;  1XCB ABF;  1XCB DE;  3JWN CGI;  3ETD AD;  3ETG ADE;  2AMF ACDE;  3JTT GH;  3FRU ACD;  3KDP ACD;  3IVK HL;  3HAE HLO;  3N2L ADE;  3FOL AB;  1OP5 KLM;  3HWX 1BS;  1A97 AC;  3JTT BDG;  1OM3 KL;  1E0J CDF;  1O5O ACD;  1E0J BEF;  3HWX 1BI;  1MUU ACD;  3GSW ABP;  3GEF BD;  1UT1 BF;  3JTT AFH;  1E0J BCD;  3HWX ABJ;  1AGC ABC;  1ZVN AB;  2AMF BD;  3FCS ABD;  1AQK HL;  1OM3 KLM;  3E3Q HIK;  3HWX AJZ;  1MUU AC;  1XCB CEFG;  3GSR ABP;  3DXA NO;  3N2L DG;  3DX6 ABC;  3EFF CD;  1XCB ACEG;  3E3Q UWX;  3F7V AB;  1ZLV HLM;  3FQW ABC;  2VSC ACD;  1XCB ADEG;  1W5F AB;  3HAE JK;  1ZLU HLM;  3JWN GN;  1MV8 AB;  3HAE AJM;  1AGD AB;  3ETG ABF;  2W5P ABC;  1XCB ABCG;  3HAE HL;  3DXA KL;  3H5A ABD;  3FFC FGH;  3GEF ABD;  3N2L EGH;  3JWN IK;  1ZLU LM;  3HWX BIR;  1XCB ABEG;  3GSR AP;  3HGM ABD;  3N2L DFGH;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3HWX BRS;  3H3F ACD;  3GJE BL;  2AMF ABCE;  3JTT ABC;  2VSC ABC;  1XCB CE;  1E0J ABEF;  3JWN CEL;  2AHR ABDE;  3H9H ACD;  3DXA ACK;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  3H3F EFH;  3GK8 HL;  3HG1 AB;  3F7Y AB;  3GJE BHL;  1OP3 HLM;  1E0J ABF;  2AHR ABCD;  3GIV AC;  1XCB BDEF;  3HAE ST;  1CQZ AB;  1OM3 HK;  1E0J EF;  3HAE ACJ;  2VSC BC;  3IXA ABE;  3DXA ACL;  3N2L EF;  3HWX IRS;  3HWX 1A;  3GMD BCF;  3N2L ACEF;  3EFF BN;  3H7B ACD;  3JTT ACH;  1AIF AHL;  3N2L ACDG;  1AGF ABC;  3E3Q DE;  2IEY AB;  3JWN GHM;  1AIF AL;  3FQX AC;  3ETD BCE;  3N2L DE;  3GMD BF;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  3GMD DH;  1A9B CDF;  3HWX AI;  1XCB ACDE;  3GIV ABC;  3H4H ABC;  3HAE LO;  3N2L ABEH;  3GJF HL;  3GSX ABP;  3GMD DFH;  3GVP CD;  2AHR ACDE;  1LSU AB;  3JWN HLN;  3N2L CDGH;  1AGE AB;  1XCB ADFG;  3HWX 1AJ;  3GSR AB;  3JTT BFH;  3HWX IRZ;  3E3Q BCG;  3JWN CEK;  3FQW AB;  3GIZ HL;  3FT4 AB;  3HAE DE;  2AMF BC;  3FON CDE;  3H9S ACD;  1O5O AD;  3FFC DFH;  1A9B ACD;  3GJE ABL;  3H9S AB;  3F7O BY;  3ETD AF;  2AMF AC;  3JWN CEN;  3FFC ACJ;  3FT4 AP;  3FFC ACF;  1ZLW HM;  3GDG ABC;  3GJF KM;  2VSC ABCD;  3KDP ABG;  2AHR AD;  3JWN HIK;  1AGB AB;  3N2L AC;  3GSU ABP;  3HWX ARS;  1ZLV HM;  3FON AB;  3HWX 1JZ;  3HWX RSZ;  3FRU EF;  1OP3 HK;  3N2L CFGH;  3GSN BHP;  3HPJ ADE;  1XCB CDEF;  3ETD BF;  3HWX 1IJ;  3ETD CDE;  3GSX AB;  2VSC AC;  3HG1 ACD;  3GVP BCD;  3FOM ABP;  3N2L ABE;  3N2L ACD;  3HAE PR;  3FQN AB;  3GSQ ABP;  1XCB AEG;  3GDG ABD;  3N2L CDG;  1AGC AC;  3N2L ABDE;  3FON ABP;  1MUU CD;  3HGM BCD;  3DX8 AC;  3HFM HL;  2AMF DE;  3HC3 HL;  3JWN GHI;  1OP3 HL;  1OM3 HKL;  3GJF ABC;  1A9E AC;  3H3F EF;  3JTT DF;  3JTT DFI;  3H4F AB;  3JWN MN;  3EFF DK;  3KDP AB;  3E3Q cdf;  3JWN LMN;  1ZLU HKL;  3GMD DEH;  3N2L BCDF;  3GSV AB;  3FRU AB;  3EFD HK;  1O5O ABCD;  3EFF CL;  3HPJ AD;  1A97 AB;  3GJE AB;  3H9H AB;  3KDP CD;  3GJE HL;  3HWX AR;  1A97 BC;  1A64 AB;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  3DXA FHJ;  3ETG CF;  1OP3 KLM;  1OM3 HM;  3N2L ADFG;  1A97 BCD;  1ZLW KM;  1KAH AB;  1E0J BCDF;  3ETD ABE;  3IXA ABC;  3HWX RZ;  3FCS AD;  3GJF ACH;  3HAE LNO;  1XCB CDE;  3H7B ACF;  3HGM CD;  3HWX BRZ;  3N2L ACDE;  1MV8 ACD;  3ETD ADE;  3FQU AC;  3HPJ ACD;  3HWX BS;  3FRU BCD;  2AMF BCD;  3FCS ACD;  3JWN CGL;  1XCB AEFG;  3H4H AC;  2W5P BC;  2BL4 AB;  1XCB DF;  3H9H ADF;  3ETD AC;  3IXA ADF;  1OP3 HKM;  3DXA AB;  3JTT ADF;  1XCB ACDG;  1E0J BCEF;  3ETG AEF;  3FT2 ABP;  1XCB BEG;  3GMD BDH;  1A1M AB;  2AHR AC;  1XCB EF;  3JWN EFH;  3HWX BJR;  3N2L AEFH;  1XCB BCE;  3FCT AB;  3JTT AGH;  3ETG ACF;  1XCB CEF;  3DL2 AB;  2AHR ADE;  3GEF BC;  3EFF AB;  2AHR BC;  3H3F FGH;  3IXA DE;  3HG1 ABC;  1MV8 ABC;  3HCV AC;  3HWX BJ;  1A9B DE;  3HGM ACD;  3DX7 AB;  3N2L CDEF;  3F7O ABY;  3DX9 CD;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  3GJE ABH;  3N2L ABEF;  3GDG BC;  1OP5 HKLM;  1OP5 KM;  3GMD CD;  3HWX AIR;  3E3Q PST;  3N2L EFG;  3JWN HIM;  1O5O ABD;  3FFC AC;  3N2L ABCF;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3FCS ABC;  3FOL AP;  1XCB AF;  3GJE AH;  3N2L ADG;  2AMF ABE;  3N2L ADEF;  3DX9 AB;  3FT2 AB;  3DXA ACF;  3KDP BCH;  3ETG BF;  3ETG BE;  3IVK ABL;  1ZLU HKLM;  3HWX 1IR;  3N2L ABC;  1A9B DF;  3JWN CE;  3HWX IJR;  1UT1 DE;  1UT1 AD;  3H3F BEF;  1MUU ABCD;  3GSW AP;  3IXA AD;  3IVK BL;  3IXA ABD;  3JWN FHL;  3N2L CDE;  3HWX AJS;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  1E0J CDEF;  1E0J ABC;  3H9S DE;  3KDP CDH;  3HWX 1AZ;  1Q8M ACD;  3DXA DEI;  3N2L FGH;  3FON CE;  2VSC BD;  1A1O ABC;  1XCB BEFG;  1ZLV HKLM;  3GIV AB;  2W5P AC;  3N2L AEG;  3FFC IJ;  3GJF DFM;  3HWX 1JS;  1X7D AB;  3GJE BH;  3JTT AD;  3FON ACE;  1UT1 AE;  3JTT GI;  3N2L AEFG;  1AGE ABC;  1KAR AB;  1ZLV HKL;  1XCB AFG;  3JTT AC;  1QEX AB;  1E0J CE;  3HAE JMO;  3GDG CD;  3ETD ACF;  3EFF AK;  3GSO AB;  3FRU AD;  3GMD DGH;  3JTT DGH;  3KDP BCG;  3HPJ ACE;  3HAE GI;  3N2L ADGH;  3JTT CDF;  3HWX 1AI;  1AGF AB;  3GIV DEF;  3JWN CFN;  3HWX 1SZ;  1XCB CDG;  1E0J ABCD;  3HWX ABR;  1Q8M BC;  2AHR ABE;  3JTT DEF;  1O5O AC;  1OP5 HK;  3HAE DFL;  3JWN CGN;  3ETG BCD;  1A1O AB;  3N2L BCEF;  1XCB ABE;  1A1N AC;  3ETG ADF;  3N2L CFG;  3JWN GIK;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  3N2L AEF;  3FCS AC;  3H7B DF;  3KDP ABH;  1XCB ADE;  3ETG DE;  3ETD ACD;  3FQU ABC;  3JTT BDF;  1XCB BCG;  3FRU ABD;  1OM3 KM;  3IVK AB;  1E0J CDE;  3ETG ACD;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3HWX RS;  3DXA DJ;  3HWX 1Z;  3JWN CEG;  3EYS HL;  3HWX ABI;  1KAE AB;  1AGD AC;  3DX8 AB;  3DXA EJ;  3HWX JRS;  3HCV ABC;  3JWN CFM;  2AHR CD;  1Q8M ABC; 
#chains in the LinkProt database with same CATH homology
 3N2L FG;  3HWX AB;  3N2L EFH;  3N2L ABD;  3KDP AB;  1A97 ABD;  3HWX BI;  3HWX 1AR;  3N2L GH;  3HWX IJZ;  3N2L EFGH;  3N2L BCDF;  1O5O ABCD;  3HWX 1S;  1A97 AB;  3KDP CD;  3HWX AIS;  3HWX ABS;  1A97 BC;  3KDP ABD;  3HWX 1JR;  3HWX BSZ;  1O5O AB;  3HWX ASZ;  3N2L CFG;  3N2L ADE;  3N2L ADFG;  1A97 BCD;  3HWX 1AB;  3HWX AS;  3N2L ADEG;  3HWX RZ;  3N2L DGH;  1A97 BD;  3KDP ACD;  3N2L CEF;  3HWX BRZ;  3EYW AB;  3N2L DE;  3HWX 1BS;  1A97 AC;  3N2L CEFG;  3HWX BS;  3N2L ACE;  3HWX 1IJ;  1O5O ACD;  3HWX 1BI;  3KDP ABC;  2BL4 AB;  3N2L AE;  3N2L AEF;  3N2L CDF;  3HWX ABJ;  3N2L DFG;  3HWX IRZ;  3N2L EH;  3HWX BJR;  3N2L BCFG;  3N2L DG;  3N2L BCDG;  3ECA BCD;  3N2L ABDE;  3N2L CDEH;  1W5F AB;  3HWX ABZ;  1A97 AD;  3HWX BJ;  3N2L ABE;  3N2L EF;  3HWX ARZ;  3F7O ABY;  3N2L ACF;  3N2L CDE;  3N2L EGH;  3HWX AJS;  3N2L DEH;  3HWX BIR;  3N2L ADEH;  3N2L BC;  3N2L ABEF;  3HWX AIR;  3F7O AB;  3HWX BRS;  3N2L ABCF;  3HWX 1BZ;  3N2L EFG;  3N2L ADG;  3N2L DFGH;  3N2L ADEF;  3HWX 1RS;  3KDP BCH;  3GVP ACD;  3HWX AR;  3HWX 1IR;  3N2L AB;  1A97 ABC;  3N2L AD;  3HWX IJR;  1O5O BCD;  3HWX 1BJ;  1CQZ AB;  1EK1 AB;  3N2L DEFG;  3HWX AJR;  3N2L AEG;  3DZD AB;  3HWX IRS;  3HWX 1A;  3N2L ACEF;  3N2L ABEG;  1O5O CD;  1O5O BD;  3N2L CDEG;  3KDP CDH;  3HWX 1AZ;  3N2L FGH;  1O5O ABD;  1A97 ACD;  3N2L ABDG;  3N2L BCD;  1CR6 AB;  3N2L ACEH;  3N2L AEH;  3HWX AI;  3N2L DEF;  3HWX 1JS;  3GVP CD;  3N2L AEGH;  3N2L AEFG;  3HWX AJ;  3N2L CEFH;  3HWX IJ;  3F7O ABX;  3N2L CD;  3N2L CDGH;  3N2L ACDE;  3N2L CF;  3HWX 1AJ;  2BI4 AB;  3N2L CDG;  3HWX BIS;  3HWX AJZ;  3N2L ACFG;  3HWX 1RZ;  1O5O BC;  3HWX JRS;  1O5O AD;  3N2L AEFH;  3N2L CDFG;  3N2L ABCE;  3N2L DEFH;  3HWX BIJ;  3HWX JSZ;  3N2L ABCD;  3N2L ADGH;  3F7O BY;  3HWX 1AI;  3HWX ISZ;  3HWX AIJ;  3HWX 1SZ;  3N2L DEG;  3HWX ABR;  3KDP ABG;  3N2L AC;  1O5O AC;  3HWX ARS;  3HWX BJZ;  3HWX 1JZ;  3HWX RSZ;  3N2L BCEF;  3GVP BD;  3N2L CFGH;  3HWX BIZ;  3N2L ACDG;  3N2L EG;  3HWX AIZ;  3N2L ACEG;  1EK2 AB;  3N2L ACDF;  3KDP ABH;  3N2L CDEF;  3GVP BCD;  3HWX 1BR;  3ECA ACD;  3N2L ABC;  3N2L ACD;  1O5O ABC;  3HWX RS;  3HWX IS;  3HWX 1Z;  3N2L DEGH;  3N2L ABEH;  3HWX ABI;  3KDP BCG;  3HWX AZ;  3HWX 1IZ;  3KDP ACG;  3HWX SZ;  3KDP CDG;  3HWX BJS;  3N2L BCF;  3HWX IJS;  3N2L BCDE; 

6JXHA 6JXJA 6JXIA 2ZXEA 5AW9A 5AVQA 5AVUA 5AVWA 5YLUA 5YLVA 3A3YA 5AW8A 5AVRA 3WGUA 3WGUC 3WGVA 3WGVC 5AW6A 5AVTA 5AW4A 4HYTA 4HYTC 5AVVA 5AVSA 5AW7A 4RESA 4RESC 3KDPC 5AW5A 5AW2A 4RETA 4RETC 5AW0A 5AVZA 3B8EA 3B8EC 5AW1A 5AW3A 5AVXA 5AVYA 4HQJA 4HQJC 6JXKA 6JXKE 3N23A 3N23C 4XE5A 5Y0BA 4UX1A 4UX2A 2YN9A 2XZBA 3IXZA 2ZXEB 5AW9B 5AVQB 5AVUB 5AVWB 3A3YB 5AW8B 5AVRB 3WGUB 3WGUD 3WGVB 3WGVD 5AW6B 5AVTB 5AW4B 4HYTB 4HYTD 5AVVB 5AVSB 5AW7B 4RESB 4RESD 3KDPD 5AW5B 5AW2B 4RETB 4RETD 5AW0B 5AVZB 5AW1B 5AW3B 5AVXB 5AVYB 4HQJB 4HQJD 3N23B 3N23D 4XE5B 3KDPG 3B8EG 3B8EH
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6JXH_A;  6JXJ_A;  6JXI_A;  2ZXE_A;  5AW9_A;  5AVQ_A;  5AVU_A;  5AVW_A;  5YLU_A;  5YLV_A;  3A3Y_A;  5AW8_A;  5AVR_A;  3WGU_A;  3WGU_C;  3WGV_A;  3WGV_C;  5AW6_A;  5AVT_A;  5AW4_A;  4HYT_A;  4HYT_C;  5AVV_A;  5AVS_A;  5AW7_A;  4RES_A;  4RES_C;  3KDP_C;  5AW5_A;  5AW2_A;  4RET_A;  4RET_C;  5AW0_A;  5AVZ_A;  3B8E_A;  3B8E_C;  5AW1_A;  5AW3_A;  5AVX_A;  5AVY_A;  4HQJ_A;  4HQJ_C;  6JXK_A;  6JXK_E;  3N23_A;  3N23_C;  4XE5_A;  5Y0B_A;  4UX1_A;  4UX2_A;  2YN9_A;  2XZB_A;  3IXZ_A;  2ZXE_B;  5AW9_B;  5AVQ_B;  5AVU_B;  5AVW_B;  3A3Y_B;  5AW8_B;  5AVR_B;  3WGU_B;  3WGU_D;  3WGV_B;  3WGV_D;  5AW6_B;  5AVT_B;  5AW4_B;  4HYT_B;  4HYT_D;  5AVV_B;  5AVS_B;  5AW7_B;  4RES_B;  4RES_D;  3KDP_D;  5AW5_B;  5AW2_B;  4RET_B;  4RET_D;  5AW0_B;  5AVZ_B;  5AW1_B;  5AW3_B;  5AVX_B;  5AVY_B;  4HQJ_B;  4HQJ_D;  3N23_B;  3N23_D;  4XE5_B;  3KDP_G;  3B8E_G;  3B8E_H; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling