1AHWDE

A complex of extracellular domain of tissue factor with an inhibitory fab (5g9)
Link type Probability Chain D piercings Chain E piercings
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
view details
Unlink Unlink 63% +3E -96E +107E -126E +144E -155E +169E -182E +200E -215E
Interpreting sequences
Chain D Sequence
DIKMTQSPSSMYASLGERVTITCKASQDIRKYLNWYQQKPWKSPKTLIYYATSLADGVPSRFSGSGSGQDYSLTISSLESDDTATYYCLQHGESPYTFGGGTKLEINRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Chain D Sequence
EIQLQQSGAELVRPGALVKLSCKASGFNIKDYYMHWVKQRPEQGLEWIGLIDPENGNTIYDPKFQGKASITADTSSNTAYLQLSSLTSEDTAVYYCARDNSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI
sequence length 214,214
structure length 214,214
publication title The mechanism of an inhibitory antibody on TF-initiated blood coagulation revealed by the crystal structures of human tissue factor, Fab 5G9 and TF.5G9 complex.
pubmed doi rcsb
molecule tags Complex (immunoglobulin/tissue factor)
molecule keywords IMMUNOGLOBULIN FAB 5G9 (LIGHT CHAIN)
source organism Homo sapiens
pdb deposition date1997-04-10
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
DE PF07654 C1-setImmunoglobulin C1-set domain
DE PF07686 V-setImmunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ahwD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ahwD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ahwE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ahwE02
3HPJBDE 1AGBAC 3E2HABQ 1ZLWHLM 3FT3AP 1OP3HKL 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3IXADF 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3GJFDF 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 1AGBABC 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3HAEHL 1A9BBDF 3HPJDEF 1AHWDE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3JTTDEI 3JTTAEI 1ZLUKLM 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HNVHL 1OP3HM 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 1Q8MBC 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 1A1MAC 3E3QeF 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1Q8MCD 3FOMAB 3HPJACE 3H9SACD 3FT4AP 1ZLVHL 2VSCAC 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3H9HABC 1OP5HL 3FONCD 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HAEDFK 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IVKBL 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3EFFAM 3FQRABC 3DX8ABC 3HCVAB 3HAEST 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3DXAAKM 3GJFEH 1A9BAB 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3HAEPQR 3IVKAH 3HG1ABC 1AGFAC 1OP3HLM 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JTTCGH 3GIZHL 3GSWABP 1AGCABC 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 1ZLULM 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3E3QBCG 3FFCACF 3H9HACD 3GSNAB 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3DXAFH 3F7YAB 1OP3HKM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 3E3QADQ 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3HC3HL 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3DX9CD 1OP5KM 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1AIFHL 3HAEJMO 3FCTAB 3JTTAGH 3H7BDF 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1OP5HKLM 3E3QPST 3H9SACE 3HG1ACD 3FFCAC 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3GIVADE 1ZLUHKLM 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 3GSOAB 3FRUAD 1OM3HK 3JTTCDF 1AGFAB 3GJEABL 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3E3QDE 3DXAEJ
chains in the LinkProt database with same CATH superfamily
3HPJBDE 1AGBAC 3H4FABC 3E2HABQ 1ZLWHLM 3KDPABC 1OP3HKL 1SLVAB 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3JWNHLM 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3FT3AP 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3H4HBC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 3JTTDG 3JWNCGK 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FCSBC 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3JWNFIK 3HAEHL 1A9BBDF 3E3QBCG 1AHWDE 1UT1DE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 3HG1ABC 3H9SACE 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3FCSABC 3JTTAEI 1ZLUKLM 1Q8MBC 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HPJDEF 3HNVHL 3JWNIKN 3H4FBC 1OP3HM 3JTTDGH 3JWNFGN 1AGBABC 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 3FONCD 1UT1CF 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 3GEFACD 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3K5SAB 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3GEFAB 3H4HAB 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 3GIVADE 1A1MAC 3E3QeF 1UT1AD 3KDPCDG 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3JWNCFN 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1GMECD 3FOMAB 3KDPABD 3JWNHIL 2W5PAB 3FT4AP 1ZLVHL 2VSCAC 1UT1ADE 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3GEFBCD 1ZXKAB 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3JWNIKL 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3H4FAC 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3GJFDF 3H9HABC 1OP5HL 3GSNAB 3JWNHMN 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HPJACE 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IXADF 3FCSAB 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3JWNEHK 3EFFAM 3FQRABC 3JWNCEH 3DX8ABC 3HCVAB 3HAEST 3JWNCFL 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3JWNGHM 3H9SABC 3FCSAD 3JWNHLN 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3JWNHN 3DXAAKM 3GJFEH 3GEFCD 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FCSBCD 3FQNABC 3GEFABC 3H4HABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3JWNCGH 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3DX7AB 3HAEPQR 3IVKAH 3JWNEHN 1AGFAC 3JWNCEM 3HAEDFM 1A9BACF 3FQTAC 3FCSCD 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3KDPACD 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JWNGH 3JTTCGH 3GIZHL 3GSWABP 3GEFBD 1UT1BF 1AGCABC 1ZVNAB 3FCSABD 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3JWNGN 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3GEFABD 3JWNIK 1ZLULM 3GSRAP 3H7BDEF 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3JWNCEL 3FFCACF 3H9HACD 3DXAACK 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3GEFAD 3F7YAB 1OP3HKM 1OP3HLM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 1Q8MCD 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 1UT1BC 3E3QADQ 3JWNCEK 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3H9SACD 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3KDPABG 3JWNHIK 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3JWNIKM 3HC3HL 3JWNGHI 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3H4FAB 3JWNMN 3DXAFH 3KDPAB 3E3Qcdf 3JWNLMN 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3KDPCD 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 2W5PABC 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3FCSACD 3JWNCGL 3DX9CD 3H4HAC 2W5PBC 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1UT1AE 1AIFHL 3JWNEFH 3FCTAB 3JTTAGH 3JWNGIK 3H7BDF 3GEFBC 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3GEFAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1A9BAB 1OP5HKLM 1OP5KM 3E3QPST 3JWNHIM 3HG1ACD 3FFCAC 1GMEAB 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3JTTDEI 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3KDPBCH 1ZLUHKLM 3FRUEF 1A9BDF 3JWNCE 3FFCACE 3GSWAP 3IXAAD 3IVKBL 3JWNFHL 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3KDPCDH 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 3JWNCGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 1QEXAB 3HAEJMO 3GSOAB 3FRUAD 1OM3HK 1UT1BCF 3HAEDFK 3JTTCDF 1AGFAB 3GJEABL 3JWNCEN 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3JWNCGN 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 2W5PAC 3FCSAC 3KDPABH 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3JWNCEG 3KDPBCG 3E3QDE 3DXAEJ 3JWNGMN 3JWNCFM
chains in the LinkProt database with same CATH topology
3HPJBDE 1AGBAC 3E2HABQ 1ZLWHLM 3FT3AP 1OP3HKL 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3IXADF 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3GJFDF 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 1AGBABC 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3HAEHL 1A9BBDF 3HPJDEF 1AHWDE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3JTTDEI 3JTTAEI 1ZLUKLM 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HNVHL 1OP3HM 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 1Q8MBC 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 1A1MAC 3E3QeF 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1Q8MCD 3FOMAB 3HPJACE 3H9SACD 3FT4AP 1ZLVHL 2VSCAC 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3H9HABC 1OP5HL 3FONCD 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HAEDFK 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IVKBL 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3EFFAM 3FQRABC 3DX8ABC 3HCVAB 3HAEST 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3DXAAKM 3GJFEH 1A9BAB 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3HAEPQR 3IVKAH 3HG1ABC 1AGFAC 1OP3HLM 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JTTCGH 3GIZHL 3GSWABP 1AGCABC 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 1ZLULM 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3E3QBCG 3FFCACF 3H9HACD 3GSNAB 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3DXAFH 3F7YAB 1OP3HKM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 3E3QADQ 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3HC3HL 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3DX9CD 1OP5KM 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1AIFHL 3HAEJMO 3FCTAB 3JTTAGH 3H7BDF 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1OP5HKLM 3E3QPST 3H9SACE 3HG1ACD 3FFCAC 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3GIVADE 1ZLUHKLM 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 3GSOAB 3FRUAD 1OM3HK 3JTTCDF 1AGFAB 3GJEABL 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3E3QDE 3DXAEJ
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  1ZLW HLM;  3FT3 AP;  1OP3 HKL;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3IXA DF;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3GJF DF;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3HAE HL;  1A9B BDF;  3HPJ DEF;  1AHW DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3JTT DEI;  3JTT AEI;  1ZLU KLM;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HNV HL;  1OP3 HM;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  1Q8M BC;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  1A1M AC;  3E3Q eF;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1Q8M CD;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  1ZLV HL;  2VSC AC;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3H9H ABC;  1OP5 HL;  3FON CD;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HAE DFK;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IVK BL;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3EFF AM;  3FQR ABC;  3DX8 ABC;  3HCV AB;  3HAE ST;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3DXA AKM;  3GJF EH;  1A9B AB;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3HAE PQR;  3IVK AH;  3HG1 ABC;  1AGF AC;  1OP3 HLM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JTT CGH;  3GIZ HL;  3GSW ABP;  1AGC ABC;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  1ZLU LM;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3E3Q BCG;  3FFC ACF;  3H9H ACD;  3GSN AB;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3DXA FH;  3F7Y AB;  1OP3 HKM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  3E3Q ADQ;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3HC3 HL;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3DX9 CD;  1OP5 KM;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1AIF HL;  3HAE JMO;  3FCT AB;  3JTT AGH;  3H7B DF;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1OP5 HKLM;  3E3Q PST;  3H9S ACE;  3HG1 ACD;  3FFC AC;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3GIV ADE;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  3GSO AB;  3FRU AD;  1OM3 HK;  3JTT CDF;  1AGF AB;  3GJE ABL;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3E3Q DE;  3DXA EJ; 
#chains in the LinkProt database with same CATH topology
 3HPJ BDE;  1AGB AC;  3H4F ABC;  3E2H ABQ;  1ZLW HLM;  3KDP ABC;  1OP3 HKL;  1SLV AB;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3JWN HLM;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3FT3 AP;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3H4H BC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  3JTT DG;  3JWN CGK;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FCS BC;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3JWN FIK;  3HAE HL;  1A9B BDF;  3E3Q BCG;  1AHW DE;  1UT1 DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  3HG1 ABC;  3H9S ACE;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3FCS ABC;  3JTT AEI;  1ZLU KLM;  1Q8M BC;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HPJ DEF;  3HNV HL;  3JWN IKN;  3H4F BC;  1OP3 HM;  3JTT DGH;  3JWN FGN;  1AGB ABC;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  3FON CD;  1UT1 CF;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  3GEF ACD;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3K5S AB;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3GEF AB;  3H4H AB;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  3GIV ADE;  1A1M AC;  3E3Q eF;  1UT1 AD;  3KDP CDG;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3JWN CFN;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1GME CD;  3FOM AB;  3KDP ABD;  3JWN HIL;  2W5P AB;  3FT4 AP;  1ZLV HL;  2VSC AC;  1UT1 ADE;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3GEF BCD;  1ZXK AB;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3JWN IKL;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3H4F AC;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3GJF DF;  3H9H ABC;  1OP5 HL;  3GSN AB;  3JWN HMN;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HPJ ACE;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IXA DF;  3FCS AB;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3JWN EHK;  3EFF AM;  3FQR ABC;  3JWN CEH;  3DX8 ABC;  3HCV AB;  3HAE ST;  3JWN CFL;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3JWN GHM;  3H9S ABC;  3FCS AD;  3JWN HLN;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3JWN HN;  3DXA AKM;  3GJF EH;  3GEF CD;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FCS BCD;  3FQN ABC;  3GEF ABC;  3H4H ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3JWN CGH;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3DX7 AB;  3HAE PQR;  3IVK AH;  3JWN EHN;  1AGF AC;  3JWN CEM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3FCS CD;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3KDP ACD;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JWN GH;  3JTT CGH;  3GIZ HL;  3GSW ABP;  3GEF BD;  1UT1 BF;  1AGC ABC;  1ZVN AB;  3FCS ABD;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3JWN GN;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3GEF ABD;  3JWN IK;  1ZLU LM;  3GSR AP;  3H7B DEF;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3JWN CEL;  3FFC ACF;  3H9H ACD;  3DXA ACK;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3GEF AD;  3F7Y AB;  1OP3 HKM;  1OP3 HLM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  1Q8M CD;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  1UT1 BC;  3E3Q ADQ;  3JWN CEK;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3H9S ACD;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3KDP ABG;  3JWN HIK;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3JWN IKM;  3HC3 HL;  3JWN GHI;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3H4F AB;  3JWN MN;  3DXA FH;  3KDP AB;  3E3Q cdf;  3JWN LMN;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3KDP CD;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  2W5P ABC;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3FCS ACD;  3JWN CGL;  3DX9 CD;  3H4H AC;  2W5P BC;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1UT1 AE;  1AIF HL;  3JWN EFH;  3FCT AB;  3JTT AGH;  3JWN GIK;  3H7B DF;  3GEF BC;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3GEF AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1A9B AB;  1OP5 HKLM;  1OP5 KM;  3E3Q PST;  3JWN HIM;  3HG1 ACD;  3FFC AC;  1GME AB;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3JTT DEI;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3KDP BCH;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3JWN CE;  3FFC ACE;  3GSW AP;  3IXA AD;  3IVK BL;  3JWN FHL;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3KDP CDH;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  3JWN CGI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  1QEX AB;  3HAE JMO;  3GSO AB;  3FRU AD;  1OM3 HK;  1UT1 BCF;  3HAE DFK;  3JTT CDF;  1AGF AB;  3GJE ABL;  3JWN CEN;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3JWN CGN;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  2W5P AC;  3FCS AC;  3KDP ABH;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3JWN CEG;  3KDP BCG;  3E3Q DE;  3DXA EJ;  3JWN GMN;  3JWN CFM; 
#chains in the LinkProt database with same CATH homology
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  1ZLW HLM;  3FT3 AP;  1OP3 HKL;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3IXA DF;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3GJF DF;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3HAE HL;  1A9B BDF;  3HPJ DEF;  1AHW DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3JTT DEI;  3JTT AEI;  1ZLU KLM;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HNV HL;  1OP3 HM;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  1Q8M BC;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  1A1M AC;  3E3Q eF;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1Q8M CD;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  1ZLV HL;  2VSC AC;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3H9H ABC;  1OP5 HL;  3FON CD;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HAE DFK;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IVK BL;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3EFF AM;  3FQR ABC;  3DX8 ABC;  3HCV AB;  3HAE ST;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3DXA AKM;  3GJF EH;  1A9B AB;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3HAE PQR;  3IVK AH;  3HG1 ABC;  1AGF AC;  1OP3 HLM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JTT CGH;  3GIZ HL;  3GSW ABP;  1AGC ABC;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  1ZLU LM;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3E3Q BCG;  3FFC ACF;  3H9H ACD;  3GSN AB;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3DXA FH;  3F7Y AB;  1OP3 HKM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  3E3Q ADQ;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3HC3 HL;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3DX9 CD;  1OP5 KM;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1AIF HL;  3HAE JMO;  3FCT AB;  3JTT AGH;  3H7B DF;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1OP5 HKLM;  3E3Q PST;  3H9S ACE;  3HG1 ACD;  3FFC AC;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3GIV ADE;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  3GSO AB;  3FRU AD;  1OM3 HK;  3JTT CDF;  1AGF AB;  3GJE ABL;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3E3Q DE;  3DXA EJ; 

4NZUL 1MJUL 4TRPL 1MEXL 3D9AL 3TV3L 1NCWL 5UD9L 6DDMA 5TY6L 2XZCL 2XKNA 2XKNC 6MEEB 6MEED 6BJZL 5KVGL 5WCAL 4XCFL 5KVFL 1RUPL 1RUKL 5VXRL 5X08L 6NB8L 6A76L 6U1TL 6MEGL 4XAWL 3N9GL 4TULL 5UCBL 2VXVL 4GXVL 4GXVM 2VXTL 6CR1L 1RUML 2XZAL 2W60B 5W24L 4HPYL 3T65A 4JG1L 6E65L 3M8OL 5I8CB 4O5LL 5MYXA 5MYXC 3IFLL 5WK2L 3PP4L 3KDMA 3KDML 5NIVA 5N4JL 2AJUL 2AJVL 5X4GB 3SY0A 4PTUA 4TPRL 4HS6A 4HS6L 3IFNL 5U3PL 6BLAL 4TOYL 4TUOB 4TUOD 3NPSC 1RURL 5ADOL 4XC3L 4M5YL 4M5YM 4TQEL 4ISVA 4XC1L 5VSIL 5ODBB 4CMHC 5JXAL 3QHZL 3QHZM 6QCUL 3UJIL 3NTCL 4YNYB 4YNYD 4TUKL 4YO0B 4YO0D 6AZMA 6AZMC 6BE3L 4NWUL 3HC4L 5VZRB 5VZRL 2W9DL 5EWIL 5E2WL 5MYKA 4NZRL 5MYOA 5MYOC 4HBCL 4AEHL 5UELL 2V17L 4J6RL 5E2VL 5SY8L 5OCKL 5DD1L 5JUEL 5CINL 5JR1L 6CA7L 3CFBA 3CFBL 3WIIL 3WIIM 5OB5L 3BKJL 5I66B 4JAMB 4JAML 6BZYL 3QQ9C 3QQ9L 5TKKL 5FGBA 5FGBB 5W6CL 5I1KL 3OZ9L 4JDVB 4JDVL 5V7UL 5UEAB 5UEAL 4AL8L 3G5YA 5NMVL 4N8CL 4N8CM 5AZ2L 4HGWA 1NLBL 1C5CL 3VFGL 5TDNA 5TDNC 3QRGL 5M6AA 5M6AB 5M6AC 5M6AD 4LLYB 4LLYD 4EBQL 5EZIL 4K23L 3NCJL 3UO1L 4M1GL 5W05L 2IPUK 2IPUL 3HC3L 4M61A 4M61C 5YE3A 3BKML 1UM5L 3QHFL 4NWTL 3WHXB 3NA9L 3BAEL 6RCOB 6RCOD 1NGZA 4LRIA 4LRIB 4ZTPL 4JN2A 4JN2L 4XBEL 1MJ8L 6BE2L 4JFZL 6ARPA 6ARPC 3WIFB 5U6AA 5KVDL 3MBXL 3TWCL 6APCL 4HHAA 4RGOL 5UEKL 3NAAL 1Q0XL 4R90L 4XVTL 5IK3B 5IK3D 5NPHL 5XLIa 5XLIb 5IHZB 5IHZD 5IHZF 5IHZL 6DC4L 2R1XA 5U3DA 4WUKL 3MLYL 3MLYM 5U3OL 5JOPD 5JOPL 4HPOL 5UKNL 6BHZL 6BHZM 5IT2L 6MY4B 6MY4L 4POZC 4F57L 5MO3L 5GZ0A 5GZ0C 6DW2A 6MG4A 6MG4B 6BQBL 4PUBL 6B14L 5DD6B 5DD6L 3WIHL 3WIHM 3CFCL 3V4UL 5VKDL 2R1YA 5XHGA 5XHGC 4XMPL 3UYRL 3V0WL 5OCXL 1YQVL 3OAZK 3OAZL 2R2BA 1ZANL 6CJKA 6CJKC 4N0YL 3V52L 6OTCL 5MTHB 5MTHL 3GGWA 3GGWC 1RZFL 5ZMJL 6MY5B 6MY5L 4KTEL 5I8OL 4JG0L 4YGVB 4YGVL 5U4RB 5U4RL 5ALCL 5U5FA 3EO0A 3EO0C 5CILL 6BI2L 6BI2M 5F3BB 5F3BF 4FQIL 6S5AL 4JHAL 6B9ZA 3MCLL 4PTTA 5OD0L 5KVLL 5TDOA 5TDOC 8FABA 8FABC 5NHWL 2ZPKL 2ZPKM 4DGVL 6C5KB 6C5KL 2DQUL 5TH2A 5TH2C 5I8KL 4YDLC 4YDLL 3T4YA 1YNLL 5EPMB 5EPMF 2AJSL 3BZ4A 3BZ4C 3BZ4E 3BZ4G 4NUJA 3LIZL 1RUAL 3U2SB 3U2SL 6PE7L 5D6CA 5D6CL 4GAGL 2R23A 4NUGL 3IU4L 3MNZA 6DC8L 3MLRL 1QYGL 6IASL 1P7KA 1P7KL 6OBZB 6OBZL 3RVVC 6GFEL 6GFEM 3P0YL 4NPYA 4NPYL 6ANAL 5IBUB 5IBUL 5VPLC 6AODA 5WCDL 2YPVL 4HH9A 4HH9C 4JY5L 6ELEB 6ELEL 5UR8B 6B5RL 3NACL 5U5MA 2DQTL 1Q72L 4M1DL 4M1DM 6MNQL 1SEQL 4YHOL 6NMTA 2R1WA 3MO1A 4DGYL 5EN2B 3T77A 6P4YL 3MXWL 2V7NA 2V7NC 2V7NE 2V7NG 3EO9L 4ALAL 6N35K 6N35L 4F33A 4F33C 4F33E 4F33G 3C6SA 3C6SC 3C6SE 3C6SG 5WUVL 4Z8FL 3OKLA 4JM4L 2HWZL 5YE4B 5YE4D 6B0GC 5TDPA 5TDPC 1ZEAL 6BAHA 6D0XB 6BE4L 5TPPL 5L88L 1Q9WA 1Q9WC 4P3CL 1L7IL 1JPTL 1AQKL 5TL5L 2FX7L 6O39A 5Y9KL 4DTGL 5CSZB 5CSZL 6GLWD 6GLWL 3WFHB 4K3DL 4K3DM 4H8WL 3HNTL 6GKUL 1WEJL 5VPGC 5HI4D 5HI4L 5NUZB 5NUZL 6QKDL 6QKDM 6QKDO 6QKDT 5FCUL 3RVWC 5DD3L 5XKUB 3D85A 4Z95L 5HI5D 5HI5L 5JO5B 5JO5D 5JO5F 5JO5L 5L9DL 5CCKL 6GXXL 5I76A 5I76C 1KCVL 1FLRL 6MTTL 5I18L 4JN1L 4P3DB 4P3DL 4G5ZL 6HKGB 3TNMB 3TNML 2OK0L 3SOBL 6B5ML 5AWNL 4ZFOL 4ZFOB 4G6ML 5DR5L 6MG5A 6MG5B 2IH3B 4KQ3L 6AQ7L 4JFXA 4JFXL 3SGEI 3SGEL 1BM3L 4TUJB 4TUJD 2VXQL 2XWTB 5FHBL 3HZMA 1JGUL 4I77L 4OCRL 4O4YL 5OBFL 6QNKA 6QNKC 5LGHL 1UZ8A 1UZ8L 1DQQA 1DQQC 5L7XL 5V6ML 5MHEL 5YFIL 4GLRI 4GLRK 5WK3P 5WK3R 5WK3T 5WK3V 6MTRL 4HJGA 4M43L 5I30L 3HC0B 3HC0L 3BKCL 6CT7B 6CT7L 3FN0L 5X5XL 4YHIB 4YHIL 5NYXL 5NYXN 5NYXP 5YUPL 4OSUL 3MXVL 5IFAL 1T2QL 6ELJB 6ELJL 4G6KL 4MAUL 3LEXB 3LEXL 6B0WL 6DC7L 6DC7M 5VH4B 5VH4L 5DQDL 5DT1L 4ONFL 1OPGL 1JPSL 1NBYA 3V6OE 3V6OF 3S96B 3S96D 6CBVL 4LKXB 1Q9OA 1Q9OC 3SE8L 5JW5B 5JW5L 5VH3B 5VH3L 6DCVA 6DCVL 5HDQL 4FQ2L 3RKDC 3RKDL 3L1OL 2A77L 2FB4L 3GO1L 1F3DJ 1F3DL 3QWOB 3QWOL 3CVIL 1PZ5A 1LK3L 1LK3M 4IOIA 1N7MH 4OKVB 4OKVD 6GHGB 6GHGL 6B5SL 5K8AA 5K8AE 5K8AL 5K8AM 5WKZL 1JGVL 5VAGB 3MLXL 3MLXM 3I9GL 5GIRB 5GIRL 6C5IL 2ADFL 5I16A 5I16L 3O41B 3O41L 5F9OL 3Q6GL 3Q6GM 1UM4L 5VJQB 5VJQD 5VJQF 5VJQH 4RBPK 4RBPL 3I75A 4XVSL 7FABL 4FQLL 1NGXA 1NGXL 1E6OL 5GISL 6H3HB 6H3HD 1JFQL 6B0SL 5FGCB 6DCWL 6DB6L 6A9KA 6A9KL 4H20L 5GGQL 4RFEB 4RFED 4RFEF 4RFEL 6B5NL 3OAYK 3OAYL 1CR9L 6ANDL 1A3LL 5W0DC 1YEJL 4GMTL 4GMTM 6BPBB 5K9JL 5DS8B 5DS8L 3ZKMD 3ZKML 1FNSL 5JRPL 3HNSL 1KELL 4DCQA 5TF1L 3TCLB 3TCLL 4OJFL 5F7EL 1N0XL 1N0XM 2FATL 1RULL 1T3FA 4WCYL 5FHAL 4H88L 5UMND 5UMNF 4X7SL 1UM6L 5DD5L 6C6XB 6C6XD 6C6XF 6C6XL 3H0TA 2AK1L 4X0KB 4X0KL 1S3KL 3HNVL 5E8EA 3LEYL 1YEIL 3QPQC 3QPQE 3QPQI 3QPQL 6PHBA 6PHBC 5TR8L 3GJFK 3GJFL 5W3PL 3UJJL 6MXRB 6MXRL 6ELLB 6ELLL 2HFFA 2HFFL 4M7KL 1NDGA 3OKDA 2IPTL 1SBSL 1VGEL 6DLAL 6HF1B 6HF1E 6MXSB 6MXSL 4YDKL 4MA3A 4MA3L 5GGSB 5GGSD 2FBJL 1RUQL 2HKFL 4YHYC 4YHYL 5LQBL 4M6NL 1YECL 6FLCA 6FLCL 6DG2B 6DG2D 5I1LA 5I1LL 5GGVL 5D7SL 4TSBL 6FABL 3L5XL 6IEAL 5DUBB 5DUBL 2YMXL 5BJZH 5BJZL 2NXYC 5T29L 2R8SL 5U3NL 4HKZA 6DB8L 1R3JA 5DRNB 5DRNL 1MFBL 6DDRA 1RIUL 3OKKA 5IG7B 5IG7E 5IG7H 5IG7K 6PHGB 6BFSL 1MFEL 4M6ML 3BPCA 5CHNB 5CHNL 4OCSL 6MEHL 3SO3B 2YK1L 5BVJA 5BVJC 5BVJE 5BVJG 4ODTL 5CGYD 5CGYL 3IDGA 2AJXL 5EOQL 6C5HL 3RU8L 1KN2L 1KN4L 5T4ZB 5T4ZL 1MFCL 2MCG1 2MCG2 5DTFB 5DTFL 3OAUL 2BRRL 2BRRX 1LGVA 1LGVB 5WEQA 3TNNB 3TNND 3TNNF 3TNNL 5GKRB 5GKRD 5L6YL 3TJEL 6DKJB 6DKJL 3HZVA 4WY7L 5EZJB 4ZYKB 4ZYKL 6DWAA 6DWAL 4UIKL 6C9UL 1NBZA 3LS5L 5MP6L 5MP6Q 6BLHL 6E56I 6E56J 4TSCL 3FO9A 3FO9L 5E94A 5E94C 5FB8A 4FZEL 1E4WL 5N7WB 5N7WL 3U0WL 4JO1L 4JO1M 2O5XL 4HIEA 1FL3B 1FL3L 4XNQA 4XNQL 4LEXL 6IDGL 3QEGL 3SE9L 6MEDB 6MEDD 6MEDI 1CE1L 6ME1B 6ME1D 5Y9JL 1Q0YL 3EYSL 5UKPL 3WE6B 12E8L 12E8M 5ITBL 5Y11B 1A3RL 3ZL4L 1HILA 1HILC 2NY2C 1F58L 1QKZL 2G60L 4ODSL 5T5BB 5T5BL 4KMTL 2FR4A 2FR4L 3NZHL 1RHHA 1RHHC 6MQCB 6MQCL 2Q76A 2Q76C 1TJGL 6CW3B 6CW3D 1YEFL 1YEGL 4LLWB 4LLWD 6BTJB 6BTJL 6BLIB 6BLIE 6BLIH 6BLIK 6I9IB 6I9IL 3IFOB 3IFOL 1SM3L 6QN9L 4OT1L 4JPIB 4JPIL 4M7JL 4XTRD 4XTRF 1UYWL 1UYWN 2XQYK 2XQYL 3O6KL 3C5SA 3C5SC 5DQ9B 5DQ9D 5DQ9L 1RZ7L 1RZGB 1RZGD 5UKQL 1GPOL 1GPOM 2HVKB 5WL2B 5WL2L 5EA0L 1MJJA 1MJJL 5TZUL 3PGFL 5AUMB 5AUML 2QHRL 1IQDA 6DFJL 1BJMA 1BJMB 5T6LB 5T6LL 1P2CA 1P2CD 2NY4C 4NJ9L 6IGUL 1ORSA 4G6FD 4G6FL 1MLBA 4YHLL 2ZKHL 3OJDA 2NY3C 1DCLA 1DCLB 3ZKND 3ZKNL 5D70L 1LO0L 1LO0X 35C8L 6B9YA 1MIEL 4DVBB 4DVBL 2B1HL 3MA9L 5I1AA 5I1AL 1RFDL 1MFDL 6PXGB 6PXGD 6PXGF 6PXGL 2QQNL 3RVTC 6MSYL 1JVKA 1JVKB 3L5WA 3L5WL 3MCG1 3MCG2 2NY1C 6BAEA 6MTPB 6MTPL 4OGYL 4OGYN 3THML 6PA0B 4YHML 3EOTL 4MA7L 6CXYL 6H0EB 6H0ED 6H0EF 6H0EL 1LO2L 1LO2X 1UZ6E 1UZ6L 1UZ6M 1UZ6V 2D03L 5TFWL 3UJTL 3UJTM 5ADPL 3O6LL 3E8UL 1C5BL 3X3FL 4JZNB 4JZND 4JZNP 2CMRL 5IHUL 5E99L 3GNML 2FD6L 4S2SB 4S2SL 5ZV3L 4R4BA 4R4BC 4R4BE 4R4BL 1TETL 4BZ2L 5CZXD 5CZXL 2AEPL 4MSWB 5VVFL 5ILTL 6BI0L 6BI0M 4FQHB 4FQHL 5CP3A 5H2BB 6ICCL 3GRWL 5T6PA 5T6PC 4KTDL 6B3KL 5IKCA 5IKCL 3LS4L 1D5IL 4Q2ZB 4Q2ZL 1OSPL 6C6ZD 6C6ZL 5I1DA 5I1DL 1F8TL 5VKKB 5VKKL 6AYZC 6AYZD 4LSPL 5WHJL 2R2HA 1DQJA 1RIVL 3QCUL 3QCUM 1Q9KA 4OTXL 4OTXM 4EOWL 1K4CB 2NXZC 6O3AA 5W5ZL 1E4XL 1E4XM 4QHUA 4QHUL 6E9HB 6CDOB 1UJ3A 3CLFL 5DRXB 5DRXL 4HIXL 5B6FA 5B6FC 5B6FE 5B6FG 4LKCA 1MHHA 1MHHC 4GW5A 4GW5C 1W72L 1W72M 5TJDL 5X2MK 5X2ML 4OM1L 5D93B 5D93E 4KZDL 4HCRL 4HCRN 6FLBL 4CNIB 4CNIL 1C1EL 1TJHL 1YEKL 4HIHA 4HIHC 3FFDB 1D6VL 1YY8A 1YY8C 6B3DL 4YHKL 4ONGL 6O1FL 4XH2B 4XH2D 4XH2F 4XH2I 4XH2K 4XH2L 5TE7L 4ETQB 4ETQL 3QPXL 3U4EB 3U4EL 2R0ZL 3DRQA 5CEXA 5CEXC 3NIGF 3NIGL 5IESL 6OCBL 4UV7L 5TKJB 5TKJE 5TKJH 5TKJK 1TJIL 1KEML 6RCSB 25C8L 3QNXA 3PHQA 5EOCL 5EOCM 3G5VA 4OLZL 4GSDL 6AXKB 6R8XB 3D0VA 2C1PA 2C1PL 3BJLA 3BJLB 4O51A 4O51C 4O51E 4O51L 3S34L 5VKHB 6AZXB 6AZXD 1GAFL 6J6YC 6J6YF 2P7TB 6NFUB 5GKSB 5GKSD 3MODL 4HXAL 5E2TL 6GRZA 6GRZB 6B6ZA 6B6ZC 1NDMA 2IQAA 2IQAL 1H0DA 2F5BL 3MNWA 6NMSA 6NMSL 1IL1B 1NC2A 1NC2C 1U8IA 6EMJB 6EMJL 5W1GL 2VDRL 5HI3D 5HI3L 1INDL 6CNRL 2RCSL 5OCAL 1JGLL 4G6JL 2AJ3A 2AJ3C 2AJ3E 6B5TL 6MV5L 5DLML 5DLMM 1SY6L 3T3PF 3T3PL 4ZTOL 4ZTOM 4RISL 5BVPL 1EMTL 5MESL 5D96B 5D96I 6OKML 3IDIA 3G6AA 3G6AL 1CLOL 3PNWA 3PNWD 3PNWG 3PNWJ 3PNWM 3PNWP 3PNWS 3PNWV 1FE8L 1FE8M 1FE8N 3QO0A 4NRXB 4NRXE 4NRXL 4AMKL 2Y5TB 1L7TL 5D71L 3O2DL 5MY4A 6JEPI 6JEPL 6DLBL 6DB9L 6NFVB 4GW1A 4GW1C 6DDVA 6B08B 3HI6L 3HI6Y 1LHZA 1LHZB 4BJLA 4BJLB 5O14D 5O14L 3IJHA 3IJHC 1XGPA 4ZFGL 6QN7B 6QN7L 5V7RL 3LMJL 6B5OL 2VL5B 2VL5D 1YNKL 6A77L 5XQWL 2YKLL 5T78A 5T78C 1DQDL 1AJ7L 2R0LL 4M93C 4M93L 6BB4L 6BB4M 6BB4N 1DN0A 1DN0C 2PCPA 2PCPC 1AY1L 4ODVL 1MH5A 1MH5L 5M6IB 5M6IA 4MA8L 5VK6B 6E4ZL 4P9ML 5X2NK 5X2NL 5BK1D 5BK1L 3SGDI 3SGDL 6N7UB 3HZYA 6MNRL 3GIZL 2HRPL 2HRPM 3QNZA 5NBIL 5Y2KB 5Y2KD 5Y2KF 5Y2KH 1I8MA 1I8ML 5U3LB 5U3LL 6A0ZL 6N32L 6N32M 3NIDF 3NIDL 3Q1SL 1U8HA 6TYBL 6DWCA 6DWCL 3FO2A 3FO2L 5HHVL 1KCUL 2CK0L 1AXTL 4JO4L 4JO4M 1VPOL 5F96L 1NBVL 4IMKC 4IMKD 6PXHD 6PXHL 1OAKL 5VR9B 5VR9L 1XGUA 5VZ1A 5VZ1C 5IFHL 4JZOB 4JZOE 4JZOF 4JZOH 2F5AL 4LSUL 4OLUL 5OD8B 3KR3L 5DK3A 5DK3F 2HKHL 1UB5B 1UB5L 4KVCL 4R97B 4M5ZL 4OLXL 2AJYL 1DQML 4YUEL 4XNYL 6RCQB 6DZNL 1YEEL 1QBLL 2NY0C 4LSQL 4K3EL 4K3EM 3ZE2F 3ZE2L 1F4XL 4YHZL 6FS0L 6E9KB 4RWYL 4LVOB 4YHNB 4YHNL 5GGUB 5GGUL 3MOAL 5IJVA 5IJVC 5IJVE 5IJVL 3GHBL 3GHBM 2VDOL 3S35L 3HZKA 3QO1A 3OKNA 3GBNL 2PR4L 4D9QD 4D9QL 1A4JA 1A4JL 5KW9L 3QNYA 3QNYC 4LVNB 5MI0C 3VG0L 5ALBL 4ODUB 4ODUL 5JORA 5JORC 5JORE 5JORL 5N2KA 5N2KC 5N2KE 5N2KI 5N2KK 5N2KM 5N2KO 5N2KG 4PLJC 4PLJL 1BGXL 5UKOL 5MVGA 5MVGB 1YYML 1YYMQ 3ZDXF 3ZDXL 5J13B 6BITK 6BITL 3DGGA 3DGGC 1MJ7L 6FY2L 6FY2Y 2Z4QA 5W2BL 1CT8A 1CT8C 5DRWB 5T1LA 5T1LC 1FL5A 1FL5L 2VDQL 2O5ZL 4OM0L 6ELUC 6ELUF 6ELUI 6ELUL 3H42L 1MREL 5MVZB 5MVZL 5FF6A 5FF6C 3AAZB 3AAZL 6BZWB 6BZWD 6BZWF 6BZWH 4QXGL 3WFDL 1XGQA 6C5JL 3O2VL 6E4XY 3NIFF 3NIFL 4LSRL 2I5YL 2I5YQ 2CGRL 5T1KA 5T1KC 5ID0A 5ID0C 2FX9L 2FX9M 4BZ1L 5AZEL 1MRDL 1GIGL 4WHTB 4WHTD 4WHTF 4WHTH 4WHTJ 4WHTL 4WHTN 4WHTP 4WHTR 4WHTT 4WHTV 4WHTY 5T1MA 5T1MC 3C08L 2NY7L 6AXLB 6AXLC 3U1SL 6D9GB 6D9GD 5ICYA 5ICYC 1BZ7A 4LLUB 4LLUD 1F4WL 5F88A 5F88C 1TZGL 1TZGM 4YX2L 5IR1A 5IR1C 6HIGL 3W9DB 3W9DD 2VXUL 2VXUM 5EORL 6DB7L 6DB7M 1NC4A 1NC4C 1U95A 5IV2A 5IV2C 1IKFL 6CXGK 6CXGL 5HYQA 5HYQC 4LQFL 2DD8L 6CO3L 5YWFA 5YWFC 4NRZB 4NRZL 4NJAL 1NCBL 3C2AL 3C2AM 6QN8B 6QN8D 6QN8F 6QN8I 6QN8K 6QN8L 3BN9C 3BN9E 3MNVA 3MNVC 3GK8L 5NBWA 5NBWL 6EYNA 6EYNC 6EYNL 4HWEL 4AEIL 4AEIM 4AEIN 6DZRL 1MRFL 4QF1B 4QF1L 2AI0L 2AI0M 2AI0N 2AI0O 1S5HA 6E4YL 6DF0L 1IQWL 1A0QL 4HQQL 1U8KA 6AZKA 6AZKC 6MQRL 1XF2A 1XF2L 6DF1L 6AZLA 6AZLC 3MCKA 3MCKL 1T66C 1T66L 5TZ2L 6A67D 6A67L 2H1PL 1EAPA 6MLKL 5I2IA 5I2IC 4OCXL 6CDMB 6CDME 4QTHB 4QTHL 3GHEL 1UWXK 1UWXL 3L95A 3L95L 3V0VB 3V0VL 6AYNA 6AYNC 4YAQB 4YAQL 4OGXL 3W9EB 5TFSL 5DYOB 5DYOL 3UTZA 3UTZD 3UTZE 5E2UL 1QBML 5WHKL 5OPYL 6A0XB 6A0XD 6A0XF 6A0XH 4KZEL 3WKML 3WKMM 5WT9L 5X2QK 5X2QL 6NOVB 6NOVD 6IUTL 4HIJA 4HIJC 6MU3K 6MU3L 1LO3L 1LO3X 3FO1A 3FO1L 4XVUD 4XVUF 4XVUJ 4XVUL 5ID1A 5ID1C 5X2PK 5X2PL 5EBLB 1XGRA 5B71A 5B71C 3ZDYF 3ZDYL 6BF4C 6BF4L 6FBJL 1MRCL 6FG1D 6FG1L 5EUKA 5EUKC 3IETA 3IETC 1XF3A 1XF3L 2BMKA 2BMKL 3QCTL 5VKEB 3EYFA 3EYFC 5OTJA 5OTJL 3NABL 6AZZB 6AZZE 1NJ9A 1NJ9L 5U15B 5U15L 4Q9QL 3IDNA 5IVZA 5IVZC 1XGTA 1IGJA 1IGJC 5IQ9B 5IQ9L 5T85L 2Q8BL 5GHWL 5I1CL 5VZYL 5WNAD 5WNAL 4D9LL 4D9LM 4D9LN 4D9LO 1RZ8A 1RZ8C 4WV1A 4WV1D 1NGQL 1Q9LA 1Q9LC 2OMNA 2OMNB 6ANPA 6ANPL 5EIIB 5EIIL 4UUJB 5KZPI 5KZPJ 5KZPK 5KZPL 4QCIA 4QCIL 5EZLB 5EZLL 4OLYL 4FNLL 4FNLM 1NL0L 4UB0L 2DTML 1U92A 6AXPA 6AXPC 4KAQL 1CICA 1CICC 1FVDA 1FVDC 6EV2B 6EV2D 6EV2F 6EV2H 1C5DA 1C5DL 1BJ1J 1BJ1L 1NGPL 5IOPA 5IOPC 1U91A 5MUDA 5MUDB 5TIHL 5I1HL 5VPHC 6E9UB 2IQ9L 6IUVD 6IUVL 1F90L 3RVXC 4NZTL 2FX8L 2FX8M 2FX8N 2FX8O 1NGYA 4G6AD 4G6AL 6BFTB 6BFTL 6DFIL 5IFJB 5IFJE 5IFJH 5IFJK 1M7DA 5I1JL 3IDXL 1U8QA 4FQQA 4FQQC 4FQQE 4FQQL 5ICZA 5ICZC 5CIPB 5CIPL 6IEBF 6IEBL 6ID4D 6ID4L 1EHLL 2VDLL 2G75B 2G75D 6BPDB 3IDJA 3IDMA 1U8JA 6OBDA 6OBDL 6AO0L 5BV7L 5BV7B 5IF0B 5IF0L 4K94L 1K4DB 1IGCL 6BY3B 4L5FL 1RIHL 1MLCA 1MLCC 1FDLL 3V6FB 3V6FD 3V6FF 3V6FL 5K9QI 5K9QK 5K9QL 5K9QT 5K9QV 5K9QY 6B5LL 2B0SL 2W65B 2W65D 4NKIL 1I7ZA 1I7ZC 6AU5A 6AU5C 5USHE 5USHL 4KI5D 4KI5F 3D0LA 6N6BL 4JPKL 3QG6A 3QG6L 4FQCL 2B2XL 2B2XM 1XF4A 1XF4L 2B1AL 5XAJB 5XAJL 5XAJC 5XAJD 4ZD3L 5VEBB 5VEBL 5ITFA 5ITFC 4WEBL 6N81D 6N81L 5VZXI 5VZXL 2W0FB 2HFEB 4HT1L 6DWIA 6DWIC 6DWIE 6DWIG 6DWII 6DWIK 6DWIM 6DWIO 2Q8AL 5ETUA 5ETUC 6MQEB 6MQEL 4U0RC 4HKXB 2JK5B 2H8PB 1YEHL 3WFEL 3FCTA 3FCTC 3X3GL 5F6IC 6OL6B 5WAWL 6N16B 6N16D 6N16J 6N16L 2J4WL 15C8L 5EBWB 5W5XL 1KEGL 4TTDD 4TTDL 1NCAL 5E08L 3LRSB 3LRSD 3LRSF 3LRSL 6AZ2E 6AZ2F 2P8LA 4YDJB 4YDJL 1CZ8L 1CZ8X 3GJEA 3GJEL 5IBTL 3G04A 1RU9L 1CK0L 4X8JB 4X8JL 6CA6A 6CA6L 1UB6B 1UB6L 4DQOL 5DSCB 5DSCD 5DSCF 5DSCL 4XAKE 4XAKL 4HXBL 3WFCL 3R06A 3R06C 3R06E 3R06L 1WC7A 1WC7L 3G5XA 3G5XC 2Z92B 4YR6B 4YR6E 5E8DL 4JO2L 4JO2M 5JQ6L 1A4KA 1A4KL 5ICXA 5ICXC 1CF8L 6DF2A 6DF2L 3T3MF 3T3ML 1KC5L 4I2XA 4I2XC 5OCCL 5MO9L 6BY2B 5LDNL 3HR5A 3HR5L 3HR5P 3HR5Q 4K2UL 4K2UM 6OY4C 5XRQB 5XRQL 3O6ML 6JBTL 5EC2B 6AL4A 6AL4C 6AL4E 2I60L 2I60Q 5WCCB 5WCCL 1A6TA 1A6TC 4NGHL 5WB9L 2G5BA 2G5BC 2G5BE 2G5BG 4EDWL 6BPAC 6BPAF 2DDQL 4MA1C 4MA1F 4MA1L 1UCBL 5ESQA 5ESQC 1FVEA 1FVEC 2NY5L 4NM4L 4NM4M 4LSTL 2VDPL 4WFED 4WFEF 3U7YL 6OORL 6AVNL 1U8MA 1R3IL 3MACL 4D9RD 4D9RL 4F3FA 3U7WL 4XWGL 4JO3L 4JO3M 6PHHB 6PHHD 2H9GA 2H9GL 4G7VL 6B5PL 2ADGA 4HDIA 4HDIL 2AJZA 2AJZL 5ESAB 1I9JL 5W06L 4HFWA 4HFWL 4O9HL 3L7EA 3L7EL 1Y0LA 1Y0LC 1Y0LE 1Y0LL 5MP5B 5MP5D 5MP5F 5MP5L 6NMUA 6NMUL 6GC2L 2XRAL 5X2OK 5X2OL 4LIQL 3MLTA 3MLTD 3MLTG 3MLTL 6E9IB 6E9ID 6E9IL 4S1QL 5JO4B 5JO4D 4KQ4L 3INUL 3INUN 3OKOA 1R3LA 5EU7C 5EU7D 5T80L 3DIFA 3DIFC 4NCC1 4NCCL 4LBEB 5OCYL 4PB9L 3LEVL 2VQ1A 2VQ1E 5UBYL 4OLVL 1RJLA 1BQLL 2ORBL 2ORBM 4UINL 6MNSB 6MNSL 1MCIA 1MCIB 1IGIL 1DFBL 6DCAL 6DCAM 6DCAN 6DCAO 4G3YL 1MAML 2VDKL 1PLGL 2EH7L 5KG9B 5KG9L 6CDPB 5X8MC 6MTJL 1BFOA 1BFOC 1BFOE 1BFOG 6AMJA 6AMJL 5VGAA 1RZJL 5CEYA 5CEYC 3MUGA 3MUGC 3MUGE 3MUGG 3MUGI 3MUGK 3OKEA 4HIIA 4HIIC 4HK0B 4HK0D 1K6QL 2EH8L 4F58L 4F58M 4F58N 4F58O 1KCSL 1AD0A 1AD0C 4DN3L 4U6VL 4U6VM 4LSSL 4EDXA 4EDXL 1MPAL 3IF1A 3IF1C 5WNBL 5WNBM 2XA8L 4JFYA 4JFYL 4JY6A 4JY6C 3MOBL 3EYVA 3EYVL 2JELL 1GC1L 3STLB 1FORL 5CMAA 1HKLL 4QXUL 3EYUL 3PP3K 3PP3L 1MIML 2R0WL 5DQJB 5DQJL 5IJKC 5IJKD 3CFDA 3CFDL 1NCCL 1NCDL 3BDYL 5I8EB 5I8ED 5DMGD 5DMGF 5DMGL 1MCNA 1MCNB 1MCSA 1MCSB 5TE6L 5DRZA 5DRZL 1IFHL 2UYLA 2UYLM 2UYLV 2UYLX 3FZUD 3FZUL 1G9ML 1EJOL 4J8RA 4J8RC 3CMOL 3CMOX 5UIXL 3K2UL 4BH8A 4PB0L 3RVUC 1CU4L 1U8NA 3ULSA 3ULSL 6MFTB 6MFTL 4R7DB 4R7DD 4R7DF 4R7DH 4R7DJ 4R7DL 4R7DN 4R7DP 4OUUA 4OUUL 4WFFD 4WFFF 5A16B 5A16D 5A16F 5A16H 4HWBL 1CBVL 5HPMA 5HPMC 1AXSA 1AXSL 5YSLB 5YSLD 5YSLF 5YSLH 3OKMA 3MLSL 3MLSM 3MLSN 3MLSO 1U93A 5V6LL 5V6LM 4O58L 2IH1B 6AL0L 1XF5A 1XF5C 4XNMA 4XNML 5VSHB 5VSHD 5VSHF 5VSHL 3O2WL 1PG7L 1PG7M 1PG7W 1PG7Y 1FGNL 5U3ML 5TPLL 5UXQB 5UXQL 2HFGL 3CFJA 3CFJC 3CFJE 3CFJL 2MPAL 3GKWL 4Z7QF 4Z7QL 2A1WL 2A1WM 2Y07L 4YHPB 4YHPD 4YHPF 4YHPL 6NMVL 3JWDL 3JWDO 3O0RL 5ZIAB 5ZIAE 5ZIAI 5ZIAL 5ZIAM 5ZIAP 4JQIL 6B0HA 6B0HC 1MCKA 1MCKB 1MCLA 1MCLB 1FAIL 3SKJL 3SKJM 3U30B 3U30E 1INEL 4XZUB 4XZUF 6B0AL 6E63C 6E63L 3QCVL 3QCVM 6F7TA 6F7TL 5EBMB 1MCDA 1MCDB 4ZPTB 4ZPTL 6MFJB 6MFJL 1M7IA 3U0TA 3U0TC 1C12A 4YDVA 4YDVL 1MCEA 1MCEB 6FY0L 6FY0M 5HYSB 5HYSD 5HYSF 5HYSL 1KB5L 5TQAB 5TQAL 3ZDZF 3ZDZL 2VDNL 1MF2L 1MF2M 3FO0L 1TQBC 5MVJB 5MVJD 5MVJF 5MVJL 4YE4L 4LCUB 3L7FA 3L7FD 3L7FL 5I15L 2FJFA 2FJFC 2FJFE 2FJFG 2FJFJ 2FJFL 2FJFM 2FJFO 2FJFQ 2FJFS 2FJFU 2FJFW 1LO4L 1MCJA 1MCJB 1LILA 1LILB 1IGFL 1IGFM 1WCBA 1WCBL 6CEZL 1MCFA 1MCFB 6BPCC 6BPCF 2XZQL 2VDML 5I1EL 4RIRB 4RIRL 6BZVB 6BZVD 6BZVF 6BZVH 5NSTA 5NSTC 4ENED 4ENEF 2BDNL 2F19L 2NYYC 6MTNL 3CLEL 2GCYA 4WHYH 4WHYJ 4WHYL 4WHYN 6MU7L 4OCYL 4JLRB 4JLRL 2QQKL 4J1UA 4J1UC 4J1UE 2PW2A 4ZSOA 4ZSOC 1ZTXL 4QNPF 4QNPL 5N4GL 1ETZA 1ETZL 5HBTC 3NGBC 3NGBF 3NGBK 3NGBL 4RRPA 4RRPB 4RRPC 4RRPD 4RRPE 4RRPF 3IJSA 3IJSC 5SX5K 5SX5L 5JQDA 5JQDB 1I9IL 2J88L 2GK0A 2GK0L 6JC2L 2F58L 1H3PL 6EWBF 6EWBI 6EWBK 6EWBL 4S1DD 4S1DF 4S1DL 4S1DP 4XGZB 4XGZD 4XGZF 4XGZI 4XGZK 4XGZL 4XGZN 4XGZP 4XGZR 4XGZT 4XGZV 4XGZX 5MTLA 5MTLB 5MTLC 5MTLD 5VLPL 4CADA 4CADD 4CADG 4CADJ 1N8ZA 2PW1A 1MCCA 1MCCB 4OAWA 4OAWC 3OR7B 6IDHL 1TPXC 5UBZL 5SZFL 4XRCA 4XRCL 4KXZI 4KXZL 4KXZM 4KXZP 5BK2D 5BK2L 3I02A 3I02C 3BT2L 2R2EA 5UTZC 5UTZG 5UTZK 5UTZL 1TZHA 1TZHL 5O1RL 5O1RM 5DD0L 6ANIL 6ANIM 6CMIC 4QWWC 4QWWE 5MUHA 5MUHB 4XMLL 4JZJB 4JZJL 1RMFL 1GGIL 1GGIM 6H2YL 5BMFL 1MNUL 5BO1L 5BO1M 6D2PL 6FOEB 6FOEL 1JHKL 4M6OL 4IJ3B 5DO2D 5DO2L 3QEHB 3QEHD 3QEHF 3QEHH 4OLWL 4JJ5A 4FQJL 3RPIB 3RPIL 1FRGL 1GGCL 1BBDL 1T4KA 1T4KC 5LSPL 5LSPT 6MWND 6MWNL 3G5ZA 4DVRL 3EYQC 1CGSL 1V7ML 1V7MM 4OD1L 1MCBA 1MCBB 1MCQA 1MCQB 1MCRA 1MCRB 1ND0A 1ND0C 1ND0E 1ND0G 2Y06L 5MUQB 5MUQL 6PI7B 6PI7E 5H35B 5H35G 5H35I 5BK3B 5BK3D 5BK3F 5BK3L 6HXWD 6HXWL 6MTSL 2OLDA 2OLDB 3WFBL 4R26L 4JY4A 4XWOD 4XWOF 4XWOJ 4XWOL 4XWOP 4XWOR 4XWOV 4XWOX 2VXSL 2VXSM 2VXSN 2VXSO 2O5YL 2Z91B 2Z91D 3MLVL 3MLVM 3GBML 3GBMM 4ZFFB 4ZFFL 3HI5L 2AABL 4XXDA 4XXDD 4F37K 4F37L 5F9WC 5F9WL 6BGTA 6H06B 6H06D 6H06F 6H06L 5MU2B 5MU2D 5MU2F 5MU2H 5MU2J 5MU2L 5MU2N 5MU2P 6FY3L 6FY3Y 3QG7L 5UKRL 4X80L 3PHOA 3CFKA 3CFKC 3CFKE 3CFKG 3CFKJ 3CFKL 3CFKM 3CFKO 3VG9B 2GJZA 2GJZL 4QT5A 4QT5L 5MP3B 5MP3L 4PP2A 4PP2C 1A5FL 1NSNL 2OJZL 2OJZM 2ATKB 1CLYL 5VCOA 5VCOC 4GW4B 4GW4L 4XBGB 4XBGD 4XBGF 4XBGI 4XBGK 4XBGL 2NLJA 1YYLL 1YYLQ 1U8LA 6MTQL 2OZ4L 1IBGL 2NY6C 5FUZL 1EO8L 4KPHL 4KPHM 3DVGA 4I9WD 4I9WF 1KCRL 1GHFL 1DBBL 6QNAB 6QNAD 6QNAF 6QNAL 1CLZL 4OD3L 4HS8L 6MU6L 2AGJL 1N64L 3I2CL 3MLUL 4JKPL 1FN4A 1FN4C 1QFUL 5M76A 5M76B 3EYOA 3EYOC 2G2RA 2G2RL 5TQ0L 4TSAL 1B6DA 1B6DB 5BZDA 5BZDC 3Q3GA 3Q3GC 3Q3GF 3Q3GJ 5HDBF 5HDBL 3ZE1F 3ZE1L 3NFSL 3B2UD 3B2UG 3B2UK 3B2UL 3B2UO 3B2UR 3B2UU 3B2UX 4DN4L 5TRPL 2FGWL 4DGIL 5L0QB 5L0QE 3F58L 1GGBL 1B2WL 6MHRB 6MHRE 2FJGA 2FJGL 1DBJL 1YMHA 1YMHC 4DKFL 4DKFM 5TLKA 5TLKE 5TLKC 5TLKG 6OGXD 6OGXL 1UWEL 1UWEU 1UWEX 1HEZA 1HEZC 4FABL 6MEJB 6MEJL 1IT9L 1DBAL 2DWEB 5LCVL 6DB5L 6DB5M 4Z7NF 4Z7NL 4GAJL 3EFDL 4JR9L 4LF3A 4LF3D 3STZB 2A6IA 6MTOL 6IAPD 6IAPL 6FXNE 6FXNG 6FXNI 6FXNN 6FXNP 6FXNR 3ZE0F 3ZE0L 5K59F 5K59L 1PSKL 5HHXL 6MUBK 6MUBL 3VW3L 3GI9L 1JNHA 1JNHC 1JNHE 1JNHG 3KS0J 3KS0L 6BFQB 6BFQD 6BFQF 6BFQL 5TE4L 3MLWL 3MLWM 1DBML 5D72L 5D72N 5ANMA 5ANMC 5ANML 5WI9E 5WI9L 3RA7L 3RA7M 1B4JL 5X0TB 5X0TD 1UWGL 1UWGX 4JPVL 6BKCL 5KN5B 5KN5E 1A8JH 1A8JL 1CL7L 6O3BA 6O3BE 1Q1JL 1Q1JM 1BAFL 4XCNB 4XCND 4XCNF 4XCNI 4XCNK 4XCNL 5F3HB 5F3HD 5F3HF 5F3HH 6QIGL 4LEOB 2OP4L 4G7YL 6B3SD 6B3SG 6B3SK 6B3SL 1BLNA 1BLNC 1IGTA 1IGTC 4PY8J 5UEML 4UIMB 4UIMD 4UIMF 4UIML 3T2NL 3T2NM 3SDYL 5VJOB 5VJOD 3DVNA 3DVNL 3IXTB 3IXTL 6FAXL 2P8MA 4I3RL 4NP4L 4NP4M 2ADIA 1FJ1A 1FJ1C 3UC0L 3UC0M 2ZCHL 1FH5L 1NLDL 4XCEB 4XCED 4XCEL 4M7ZC 4M7ZL 3IKCA 3IKCC 1BBJA 1BBJL 3BKYL 2JB5L 5WTTB 5WTTL 5I1IL 4NNPL 4NNPY 4ERSL 6CBJL 2OSLB 2OSLL 3O45B 3O45L 1HQ4A 1HQ4C 1DEEA 1DEEC 1DEEE 1MCPL 5IIEB 5IIEL 4HC1L 4HC1N 2C1OA 2C1OL 4XP9L 1HIMH 1HIMJ 5U3KB 5U3KL 4MWFB 4MWFL 3OR6B 5DURD 5DURL 2WUCL 3SQOL 4FFVC 4FFVL 4K3JL 4RGMB 4RGML 6PE8B 6PE8L 1ZWIB 5F6HJ 5F6HL 5F6HN 5F6HP 6N8DB 6N8DE 6IEKC 6IEKF 5W08H 5W08J 5W08L 5W08N 5W08P 5W08R 2DWDB 2VC2L 6CYFC 6CYFE 6CYFL 6CYFT 1YUHA 1YUHL 1FBIL 1FBIP 4C83B 4C83D 4PS4L 5GGTL 6OL5B 6OL5L 6PHCB 6PHCD 6MNFK 6MNFL 6BCKL 2A6JA 2A6JL 1F11A 1F11C 1Y18A 1Y18C 1Y18E 1Y18L 1YY9C 2HVJB 1MOEA 1MOEB 4AG4L 3NZ8B 3NZ8L 1HZHL 1HZHM 5HBVC 3HI1A 3HI1L 6FLAB 6FLAL 6EV1B 6EV1D 6EV1F 6EV1H 6EV1J 6EV1L 4PY7B 4PY7J 2BOBB 6M87A 6M87C 6M87E 6M87G 6M87I 6M87K 6AL5L 5KANI 5KANK 5KANL 4K8RC 4K8RL 3HAEG 3HAEL 3HAEN 3HAES 2Y36L 5JNYB 5JNYD 1RZKL 2DBLL 5WTGA 5WTGC 5TPWL 6A4KL 6A4KM 6A4KN 6A4KO 5VOBL 5C0ND 5C0NL 6CMGB 4OCWL 6NCPB 6NCPD 6HHCL 1BOGA 5W6GL 1G9NL 6ML8L 4KHTL 3QA3A 3QA3C 3QA3F 3QA3J 2MCPL 6E3HL 4KK8D 4KK8F 1TZIA 3LD8B 1QLRA 1QLRC 4KUZL 1EGJL 1AI1L 2IGFL 4KRPC 2XQBL 3MLZL 1CFQA 4X7TB 4X7TL 1XGYL 1XGYM 4YK4B 4YK4Y 4JPWL 4ODWB 4ODWL 2QSCL 1TQCC 1MHPL 1MHPY 4N9GB 4N9GF 4N9GL 4N9GN 4JB9L 2W9EL 1IAIL 1IAIM 3VI3E 3VI3L 6NNJL 5MV3B 5MV3D 5MV3G 5MV3J 5MV3M 5MV3P 5MV3S 5MV3V 1OTSD 1OTSF 3U9PL 3U9PM 5XMHC 5XMHL 3O11A 3O11L 1M71A 1FL6A 1FL6L 5U3JL 3NH7L 3NH7M 3NH7N 3NH7O 6MEIL 3CK0L 4RDQF 4RDQH 4RDQJ 4RDQL 4RDQN 1XCTA 1XCT