3H4FAC

Met62leu variant of nitrite reductase from alcaligenes faeclis
Link type Probability Chain A piercings Chain C piercings
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
view details
Unlink Unlink 43% +44C -69C +86C -118C +134C -151C +178C -231C +246C -258C +299C -319C +49A -59A +182A -232A +296A -340A
Interpreting sequences
Chain A Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHALAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Chain A Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHALAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
sequence length 336,336
structure length 336,336
publication title Directed evolution of copper nitrite reductase to a chromogenic reductant.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
source organism Alcaligenes faecalis
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date2009-04-19
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AC PF00394 Cu-oxidaseMulticopper oxidase
AC PF07732 Cu-oxidase_3Multicopper oxidase
AC PF00394 Cu-oxidaseMulticopper oxidase
AC PF07732 Cu-oxidase_3Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h4fA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h4fA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h4fC01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3h4fC02
3H4HAB 3H4FAB 3H4FAC 3H4HBC 3H4FABC 3H4HAC 3H4HABC 3H4FBC
chains in the LinkProt database with same CATH superfamily
3HPJBDE 1AGBAC 3H4FABC 3E2HABQ 1ZLWHLM 3KDPABC 1OP3HKL 1SLVAB 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3JWNHLM 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3FT3AP 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3H4HBC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 3JTTDG 3JWNCGK 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FCSBC 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3JWNFIK 3HAEHL 1A9BBDF 3E3QBCG 1AHWDE 1UT1DE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 3HG1ABC 3H9SACE 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3FCSABC 3JTTAEI 1ZLUKLM 1Q8MBC 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HPJDEF 3HNVHL 3JWNIKN 3H4FBC 1OP3HM 3JTTDGH 3JWNFGN 1AGBABC 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 3FONCD 1UT1CF 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 3GEFACD 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3K5SAB 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3GEFAB 3H4HAB 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 3GIVADE 1A1MAC 3E3QeF 1UT1AD 3KDPCDG 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3JWNCFN 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1GMECD 3FOMAB 3KDPABD 3JWNHIL 2W5PAB 3FT4AP 1ZLVHL 2VSCAC 1UT1ADE 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3GEFBCD 1ZXKAB 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3JWNIKL 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3H4FAC 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3GJFDF 3H9HABC 1OP5HL 3GSNAB 3JWNHMN 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HPJACE 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IXADF 3FCSAB 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3JWNEHK 3EFFAM 3FQRABC 3JWNCEH 3DX8ABC 3HCVAB 3HAEST 3JWNCFL 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3JWNGHM 3H9SABC 3FCSAD 3JWNHLN 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3JWNHN 3DXAAKM 3GJFEH 3GEFCD 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FCSBCD 3FQNABC 3GEFABC 3H4HABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3JWNCGH 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3DX7AB 3HAEPQR 3IVKAH 3JWNEHN 1AGFAC 3JWNCEM 3HAEDFM 1A9BACF 3FQTAC 3FCSCD 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3KDPACD 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JWNGH 3JTTCGH 3GIZHL 3GSWABP 3GEFBD 1UT1BF 1AGCABC 1ZVNAB 3FCSABD 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3JWNGN 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3GEFABD 3JWNIK 1ZLULM 3GSRAP 3H7BDEF 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3JWNCEL 3FFCACF 3H9HACD 3DXAACK 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3GEFAD 3F7YAB 1OP3HKM 1OP3HLM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 1Q8MCD 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 1UT1BC 3E3QADQ 3JWNCEK 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3H9SACD 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3KDPABG 3JWNHIK 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3JWNIKM 3HC3HL 3JWNGHI 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3H4FAB 3JWNMN 3DXAFH 3KDPAB 3E3Qcdf 3JWNLMN 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3KDPCD 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 2W5PABC 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3FCSACD 3JWNCGL 3DX9CD 3H4HAC 2W5PBC 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1UT1AE 1AIFHL 3JWNEFH 3FCTAB 3JTTAGH 3JWNGIK 3H7BDF 3GEFBC 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3GEFAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1A9BAB 1OP5HKLM 1OP5KM 3E3QPST 3JWNHIM 3HG1ACD 3FFCAC 1GMEAB 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3JTTDEI 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3KDPBCH 1ZLUHKLM 3FRUEF 1A9BDF 3JWNCE 3FFCACE 3GSWAP 3IXAAD 3IVKBL 3JWNFHL 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3KDPCDH 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 3JWNCGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 1QEXAB 3HAEJMO 3GSOAB 3FRUAD 1OM3HK 1UT1BCF 3HAEDFK 3JTTCDF 1AGFAB 3GJEABL 3JWNCEN 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3JWNCGN 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 2W5PAC 3FCSAC 3KDPABH 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3JWNCEG 3KDPBCG 3E3QDE 3DXAEJ 3JWNGMN 3JWNCFM
chains in the LinkProt database with same CATH topology
3H4HAB 3H4FAB 3H4FAC 3H4HBC 3H4FABC 3H4HAC 3H4HABC 3H4FBC
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3H4H AB;  3H4F AB;  3H4F AC;  3H4H BC;  3H4F ABC;  3H4H AC;  3H4H ABC;  3H4F BC; 
#chains in the LinkProt database with same CATH topology
 3HPJ BDE;  1AGB AC;  3H4F ABC;  3E2H ABQ;  1ZLW HLM;  3KDP ABC;  1OP3 HKL;  1SLV AB;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3JWN HLM;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3FT3 AP;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3H4H BC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  3JTT DG;  3JWN CGK;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FCS BC;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3JWN FIK;  3HAE HL;  1A9B BDF;  3E3Q BCG;  1AHW DE;  1UT1 DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  3HG1 ABC;  3H9S ACE;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3FCS ABC;  3JTT AEI;  1ZLU KLM;  1Q8M BC;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HPJ DEF;  3HNV HL;  3JWN IKN;  3H4F BC;  1OP3 HM;  3JTT DGH;  3JWN FGN;  1AGB ABC;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  3FON CD;  1UT1 CF;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  3GEF ACD;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3K5S AB;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3GEF AB;  3H4H AB;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  3GIV ADE;  1A1M AC;  3E3Q eF;  1UT1 AD;  3KDP CDG;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3JWN CFN;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1GME CD;  3FOM AB;  3KDP ABD;  3JWN HIL;  2W5P AB;  3FT4 AP;  1ZLV HL;  2VSC AC;  1UT1 ADE;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3GEF BCD;  1ZXK AB;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3JWN IKL;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3H4F AC;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3GJF DF;  3H9H ABC;  1OP5 HL;  3GSN AB;  3JWN HMN;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HPJ ACE;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IXA DF;  3FCS AB;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3JWN EHK;  3EFF AM;  3FQR ABC;  3JWN CEH;  3DX8 ABC;  3HCV AB;  3HAE ST;  3JWN CFL;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3JWN GHM;  3H9S ABC;  3FCS AD;  3JWN HLN;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3JWN HN;  3DXA AKM;  3GJF EH;  3GEF CD;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FCS BCD;  3FQN ABC;  3GEF ABC;  3H4H ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3JWN CGH;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3DX7 AB;  3HAE PQR;  3IVK AH;  3JWN EHN;  1AGF AC;  3JWN CEM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3FCS CD;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3KDP ACD;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JWN GH;  3JTT CGH;  3GIZ HL;  3GSW ABP;  3GEF BD;  1UT1 BF;  1AGC ABC;  1ZVN AB;  3FCS ABD;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3JWN GN;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3GEF ABD;  3JWN IK;  1ZLU LM;  3GSR AP;  3H7B DEF;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3JWN CEL;  3FFC ACF;  3H9H ACD;  3DXA ACK;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3GEF AD;  3F7Y AB;  1OP3 HKM;  1OP3 HLM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  1Q8M CD;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  1UT1 BC;  3E3Q ADQ;  3JWN CEK;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3H9S ACD;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3KDP ABG;  3JWN HIK;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3JWN IKM;  3HC3 HL;  3JWN GHI;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3H4F AB;  3JWN MN;  3DXA FH;  3KDP AB;  3E3Q cdf;  3JWN LMN;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3KDP CD;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  2W5P ABC;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3FCS ACD;  3JWN CGL;  3DX9 CD;  3H4H AC;  2W5P BC;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1UT1 AE;  1AIF HL;  3JWN EFH;  3FCT AB;  3JTT AGH;  3JWN GIK;  3H7B DF;  3GEF BC;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3GEF AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1A9B AB;  1OP5 HKLM;  1OP5 KM;  3E3Q PST;  3JWN HIM;  3HG1 ACD;  3FFC AC;  1GME AB;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3JTT DEI;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3KDP BCH;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3JWN CE;  3FFC ACE;  3GSW AP;  3IXA AD;  3IVK BL;  3JWN FHL;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3KDP CDH;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  3JWN CGI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  1QEX AB;  3HAE JMO;  3GSO AB;  3FRU AD;  1OM3 HK;  1UT1 BCF;  3HAE DFK;  3JTT CDF;  1AGF AB;  3GJE ABL;  3JWN CEN;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3JWN CGN;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  2W5P AC;  3FCS AC;  3KDP ABH;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3JWN CEG;  3KDP BCG;  3E3Q DE;  3DXA EJ;  3JWN GMN;  3JWN CFM; 
#chains in the LinkProt database with same CATH homology
 3H4H AB;  3H4F AB;  3H4F AC;  3H4H BC;  3H4F ABC;  3H4H AC;  3H4H ABC;  3H4F BC; 

5AKRA 2BW4A 1OE1A 5OF5A 5OF6A 5I6LA 5I6KA 5I6MA 2BWIA 2BW5A 2BWDA 1OE3A 1OE2A 4YSEA 4YSEB 4YSEC 5I6NA 5OF7A 5D4HA 5D4HB 5D4HC 1SNRA 1SNRB 1SNRC 2BO0A 5OF8A 5N8FA 1SJMA 1SJMB 1SJMC 5B1KA 5N8IA 2XX0A 2XX0B 5OFFA 5N8GA 6GT0A 6GSQA 2XXFA 2XXFB 6GTLA 5I6OA 6GTNA 6GTIA 5OFGA 6GTKA 2E86A 2E86B 2E86C 2PP8A 2PP8B 2PP8C 1MZYA 5F7AA 5F7AB 5F7AC 5F7BA 5F7BB 5F7BC 6GB8A 3H56A 5OFHA 2PPCA 2PPCB 2PPCC 6GBBA 1ZDSA 1ZDSB 1ZDSC 5I6PA 5N8HA 1WA0X 5D4IA 5D4IB 5D4IC 6GT2A 2PPFA 2PPFB 2PPFC 2XXGA 2XXGC 2PP7A 2PP7B 2PP7C 1N70A 5OG2A 3H4HA 3H4HB 3H4HC 1WA1X 6GBYA 5ONXA 1KCBA 5ONYA 1L9QA 1L9QB 1L9QC 1L9OA 1L9OB 1L9OC 1J9QA 1J9QB 1J9QC 2ZONA 2ZONB 2ZONC 5OG3A 1ZV2A 1NIFA 1L9PA 1L9PB 1L9PC 1L9RA 1L9RB 1L9RC 4CSPA 4CSPF 1L9TA 1L9TB 1L9TC 1L9SA 1L9SB 1L9SC 1ET7A 1NPNA 1NPNB 1NPNC 1WA2X 2PPAA 2PPAB 2PPAC 2PPEA 2PPEB 2PPEC 5OFCA 5OG4A 4CSZA 2A3TA 2FJSA 2FJSB 2FJSC 1ZDQA 1ZDQB 1ZDQC 6GCGA 1GS7A 2PP9A 2PP9B 2PP9C 2BP8A 2BP8B 1AS6A 1AS6B 1AS6C 5OG5A 1ET8A 2DWSA 1HAUA 2VM3A 2PPDA 2PPDB 2PPDC 2BP0A 2BP0B 2VW6A 2VW6B 5OFDA 2VW4A 2VW4B 2VW7A 2VW7B 1J9SA 1J9SB 1J9SC 1GS8A 5OG6A 1NIEA 1NICA 2Y1AA 1HAWA 1NPJA 1NPJB 1NPJC 2B08A 2B08B 2B08C 1RZPA 1RZPB 1RZPC 5OGFA 1AS8A 1AS8B 1AS8C 2VM4A 2AFNA 2AFNB 2AFNC 1ET5A 5OFEA 5OGGA 1J9TA 1J9TB 1J9TC 1MZZA 1MZZB 1MZZC 2DWTA 4YSCA 4YSCB 4YSCC 5D4JA 5D4JB 5D4JC 1J9RA 1J9RB 1J9RC 1NDTA 2NRDA 1AQ8A 1AQ8B 1AQ8C 1WAEA 1AS7A 1AS7B 1AS7C 1BQ5A 3H4FB 3H4FC 1NIDA 1GS6X 1RZQA 1RZQB 1RZQC 1NTDA 2VN3A 2XWZA 2XWZB 2XWZC 2XWZD 2XWZE 2XWZF 2DY2A 2JFCA 2JFCB 2JFCC 2JFCD 2JFCE 2JFCF 1NIAA 1NIAB 1NIAC 2VMJA 1NIBA 1NIBB 1NIBC 2AVFA 2AVFB 2AVFC 2AVFD 2AVFE 2AVFF 5B1JA 5B1JB 2XX1A 2XX1B 2XX1C 2XX1D 2XX1E 2XX1F 1NDRA 1NDRB 1NDRC 1NDSA 1NDSB 1NDSC 6GTJA 2P80A 2P80B 2P80C 5AKRA 2BW4A 1OE1A 5OF5A 5OF6A 5I6LA 5I6KA 5I6MA 2BWIA 2BW5A 2BWDA 1OE3A 1OE2A 4YSEA 4YSEB 4YSEC 5I6NA 5OF7A 5D4HA 5D4HB 5D4HC 1SNRA 1SNRB 1SNRC 2BO0A 5OF8A 5N8FA 1SJMA 1SJMB 1SJMC 5B1KA 5N8IA 2XX0A 2XX0B 5OFFA 5N8GA 6GT0A 6GSQA 2XXFA 2XXFB 6GTLA 5I6OA 6GTNA 6GTIA 5OFGA 6GTKA 2E86A 2E86B 2E86C 2PP8A 2PP8B 2PP8C 1MZYA 5F7AA 5F7AB 5F7AC 5F7BA 5F7BB 5F7BC 6GB8A 3H56A 5OFHA 2PPCA 2PPCB 2PPCC 6GBBA 1ZDSA 1ZDSB 1ZDSC 5I6PA 5N8HA 1WA0X 5D4IA 5D4IB 5D4IC 6GT2A 2PPFA 2PPFB 2PPFC 2XXGA 2XXGC 2PP7A 2PP7B 2PP7C 1N70A 5OG2A 3H4HA 3H4HB 3H4HC 1WA1X 6GBYA 5ONXA 1KCBA 5ONYA 1L9QA 1L9QB 1L9QC 1L9OA 1L9OB 1L9OC 1J9QA 1J9QB 1J9QC 2ZONA 2ZONB 2ZONC 5OG3A 1ZV2A 1NIFA 1L9PA 1L9PB 1L9PC 1L9RA 1L9RB 1L9RC 4CSPA 4CSPF 1L9TA 1L9TB 1L9TC 1L9SA 1L9SB 1L9SC 1ET7A 1NPNA 1NPNB 1NPNC 1WA2X 2PPAA 2PPAB 2PPAC 2PPEA 2PPEB 2PPEC 5OFCA 5OG4A 4CSZA 2A3TA 2FJSA 2FJSB 2FJSC 1ZDQA 1ZDQB 1ZDQC 6GCGA 1GS7A 2PP9A 2PP9B 2PP9C 2BP8A 2BP8B 1AS6A 1AS6B 1AS6C 5OG5A 1ET8A 2DWSA 1HAUA 2VM3A 2PPDA 2PPDB 2PPDC 2BP0A 2BP0B 2VW6A 2VW6B 5OFDA 2VW4A 2VW4B 2VW7A 2VW7B 1J9SA 1J9SB 1J9SC 1GS8A 5OG6A 1NIEA 1NICA 2Y1AA 1HAWA 1NPJA 1NPJB 1NPJC 2B08A 2B08B 2B08C 1RZPA 1RZPB 1RZPC 5OGFA 1AS8A 1AS8B 1AS8C 2VM4A 2AFNA 2AFNB 2AFNC 1ET5A 5OFEA 5OGGA 1J9TA 1J9TB 1J9TC 1MZZA 1MZZB 1MZZC 2DWTA 4YSCA 4YSCB 4YSCC 5D4JA 5D4JB 5D4JC 1J9RA 1J9RB 1J9RC 1NDTA 2NRDA 1AQ8A 1AQ8B 1AQ8C 1WAEA 1AS7A 1AS7B 1AS7C 1BQ5A 3H4FA 3H4FB 1NIDA 1GS6X 1RZQA 1RZQB 1RZQC 1NTDA 2VN3A 2XWZA 2XWZB 2XWZC 2XWZD 2XWZE 2XWZF 2DY2A 2JFCA 2JFCB 2JFCC 2JFCD 2JFCE 2JFCF 1NIAA 1NIAB 1NIAC 2VMJA 1NIBA 1NIBB 1NIBC 2AVFA 2AVFB 2AVFC 2AVFD 2AVFE 2AVFF 5B1JA 5B1JB 2XX1A 2XX1B 2XX1C 2XX1D 2XX1E 2XX1F 1NDRA 1NDRB 1NDRC 1NDSA 1NDSB 1NDSC 6GTJA 2P80A 2P80B 2P80C
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5AKR_A;  2BW4_A;  1OE1_A;  5OF5_A;  5OF6_A;  5I6L_A;  5I6K_A;  5I6M_A;  2BWI_A;  2BW5_A;  2BWD_A;  1OE3_A;  1OE2_A;  4YSE_A;  4YSE_B;  4YSE_C;  5I6N_A;  5OF7_A;  5D4H_A;  5D4H_B;  5D4H_C;  1SNR_A;  1SNR_B;  1SNR_C;  2BO0_A;  5OF8_A;  5N8F_A;  1SJM_A;  1SJM_B;  1SJM_C;  5B1K_A;  5N8I_A;  2XX0_A;  2XX0_B;  5OFF_A;  5N8G_A;  6GT0_A;  6GSQ_A;  2XXF_A;  2XXF_B;  6GTL_A;  5I6O_A;  6GTN_A;  6GTI_A;  5OFG_A;  6GTK_A;  2E86_A;  2E86_B;  2E86_C;  2PP8_A;  2PP8_B;  2PP8_C;  1MZY_A;  5F7A_A;  5F7A_B;  5F7A_C;  5F7B_A;  5F7B_B;  5F7B_C;  6GB8_A;  3H56_A;  5OFH_A;  2PPC_A;  2PPC_B;  2PPC_C;  6GBB_A;  1ZDS_A;  1ZDS_B;  1ZDS_C;  5I6P_A;  5N8H_A;  1WA0_X;  5D4I_A;  5D4I_B;  5D4I_C;  6GT2_A;  2PPF_A;  2PPF_B;  2PPF_C;  2XXG_A;  2XXG_C;  2PP7_A;  2PP7_B;  2PP7_C;  1N70_A;  5OG2_A;  3H4H_A;  3H4H_B;  3H4H_C;  1WA1_X;  6GBY_A;  5ONX_A;  1KCB_A;  5ONY_A;  1L9Q_A;  1L9Q_B;  1L9Q_C;  1L9O_A;  1L9O_B;  1L9O_C;  1J9Q_A;  1J9Q_B;  1J9Q_C;  2ZON_A;  2ZON_B;  2ZON_C;  5OG3_A;  1ZV2_A;  1NIF_A;  1L9P_A;  1L9P_B;  1L9P_C;  1L9R_A;  1L9R_B;  1L9R_C;  4CSP_A;  4CSP_F;  1L9T_A;  1L9T_B;  1L9T_C;  1L9S_A;  1L9S_B;  1L9S_C;  1ET7_A;  1NPN_A;  1NPN_B;  1NPN_C;  1WA2_X;  2PPA_A;  2PPA_B;  2PPA_C;  2PPE_A;  2PPE_B;  2PPE_C;  5OFC_A;  5OG4_A;  4CSZ_A;  2A3T_A;  2FJS_A;  2FJS_B;  2FJS_C;  1ZDQ_A;  1ZDQ_B;  1ZDQ_C;  6GCG_A;  1GS7_A;  2PP9_A;  2PP9_B;  2PP9_C;  2BP8_A;  2BP8_B;  1AS6_A;  1AS6_B;  1AS6_C;  5OG5_A;  1ET8_A;  2DWS_A;  1HAU_A;  2VM3_A;  2PPD_A;  2PPD_B;  2PPD_C;  2BP0_A;  2BP0_B;  2VW6_A;  2VW6_B;  5OFD_A;  2VW4_A;  2VW4_B;  2VW7_A;  2VW7_B;  1J9S_A;  1J9S_B;  1J9S_C;  1GS8_A;  5OG6_A;  1NIE_A;  1NIC_A;  2Y1A_A;  1HAW_A;  1NPJ_A;  1NPJ_B;  1NPJ_C;  2B08_A;  2B08_B;  2B08_C;  1RZP_A;  1RZP_B;  1RZP_C;  5OGF_A;  1AS8_A;  1AS8_B;  1AS8_C;  2VM4_A;  2AFN_A;  2AFN_B;  2AFN_C;  1ET5_A;  5OFE_A;  5OGG_A;  1J9T_A;  1J9T_B;  1J9T_C;  1MZZ_A;  1MZZ_B;  1MZZ_C;  2DWT_A;  4YSC_A;  4YSC_B;  4YSC_C;  5D4J_A;  5D4J_B;  5D4J_C;  1J9R_A;  1J9R_B;  1J9R_C;  1NDT_A;  2NRD_A;  1AQ8_A;  1AQ8_B;  1AQ8_C;  1WAE_A;  1AS7_A;  1AS7_B;  1AS7_C;  1BQ5_A;  3H4F_B;  3H4F_C;  1NID_A;  1GS6_X;  1RZQ_A;  1RZQ_B;  1RZQ_C;  1NTD_A;  2VN3_A;  2XWZ_A;  2XWZ_B;  2XWZ_C;  2XWZ_D;  2XWZ_E;  2XWZ_F;  2DY2_A;  2JFC_A;  2JFC_B;  2JFC_C;  2JFC_D;  2JFC_E;  2JFC_F;  1NIA_A;  1NIA_B;  1NIA_C;  2VMJ_A;  1NIB_A;  1NIB_B;  1NIB_C;  2AVF_A;  2AVF_B;  2AVF_C;  2AVF_D;  2AVF_E;  2AVF_F;  5B1J_A;  5B1J_B;  2XX1_A;  2XX1_B;  2XX1_C;  2XX1_D;  2XX1_E;  2XX1_F;  1NDR_A;  1NDR_B;  1NDR_C;  1NDS_A;  1NDS_B;  1NDS_C;  6GTJ_A;  2P80_A;  2P80_B;  2P80_C;  5AKR_A;  2BW4_A;  1OE1_A;  5OF5_A;  5OF6_A;  5I6L_A;  5I6K_A;  5I6M_A;  2BWI_A;  2BW5_A;  2BWD_A;  1OE3_A;  1OE2_A;  4YSE_A;  4YSE_B;  4YSE_C;  5I6N_A;  5OF7_A;  5D4H_A;  5D4H_B;  5D4H_C;  1SNR_A;  1SNR_B;  1SNR_C;  2BO0_A;  5OF8_A;  5N8F_A;  1SJM_A;  1SJM_B;  1SJM_C;  5B1K_A;  5N8I_A;  2XX0_A;  2XX0_B;  5OFF_A;  5N8G_A;  6GT0_A;  6GSQ_A;  2XXF_A;  2XXF_B;  6GTL_A;  5I6O_A;  6GTN_A;  6GTI_A;  5OFG_A;  6GTK_A;  2E86_A;  2E86_B;  2E86_C;  2PP8_A;  2PP8_B;  2PP8_C;  1MZY_A;  5F7A_A;  5F7A_B;  5F7A_C;  5F7B_A;  5F7B_B;  5F7B_C;  6GB8_A;  3H56_A;  5OFH_A;  2PPC_A;  2PPC_B;  2PPC_C;  6GBB_A;  1ZDS_A;  1ZDS_B;  1ZDS_C;  5I6P_A;  5N8H_A;  1WA0_X;  5D4I_A;  5D4I_B;  5D4I_C;  6GT2_A;  2PPF_A;  2PPF_B;  2PPF_C;  2XXG_A;  2XXG_C;  2PP7_A;  2PP7_B;  2PP7_C;  1N70_A;  5OG2_A;  3H4H_A;  3H4H_B;  3H4H_C;  1WA1_X;  6GBY_A;  5ONX_A;  1KCB_A;  5ONY_A;  1L9Q_A;  1L9Q_B;  1L9Q_C;  1L9O_A;  1L9O_B;  1L9O_C;  1J9Q_A;  1J9Q_B;  1J9Q_C;  2ZON_A;  2ZON_B;  2ZON_C;  5OG3_A;  1ZV2_A;  1NIF_A;  1L9P_A;  1L9P_B;  1L9P_C;  1L9R_A;  1L9R_B;  1L9R_C;  4CSP_A;  4CSP_F;  1L9T_A;  1L9T_B;  1L9T_C;  1L9S_A;  1L9S_B;  1L9S_C;  1ET7_A;  1NPN_A;  1NPN_B;  1NPN_C;  1WA2_X;  2PPA_A;  2PPA_B;  2PPA_C;  2PPE_A;  2PPE_B;  2PPE_C;  5OFC_A;  5OG4_A;  4CSZ_A;  2A3T_A;  2FJS_A;  2FJS_B;  2FJS_C;  1ZDQ_A;  1ZDQ_B;  1ZDQ_C;  6GCG_A;  1GS7_A;  2PP9_A;  2PP9_B;  2PP9_C;  2BP8_A;  2BP8_B;  1AS6_A;  1AS6_B;  1AS6_C;  5OG5_A;  1ET8_A;  2DWS_A;  1HAU_A;  2VM3_A;  2PPD_A;  2PPD_B;  2PPD_C;  2BP0_A;  2BP0_B;  2VW6_A;  2VW6_B;  5OFD_A;  2VW4_A;  2VW4_B;  2VW7_A;  2VW7_B;  1J9S_A;  1J9S_B;  1J9S_C;  1GS8_A;  5OG6_A;  1NIE_A;  1NIC_A;  2Y1A_A;  1HAW_A;  1NPJ_A;  1NPJ_B;  1NPJ_C;  2B08_A;  2B08_B;  2B08_C;  1RZP_A;  1RZP_B;  1RZP_C;  5OGF_A;  1AS8_A;  1AS8_B;  1AS8_C;  2VM4_A;  2AFN_A;  2AFN_B;  2AFN_C;  1ET5_A;  5OFE_A;  5OGG_A;  1J9T_A;  1J9T_B;  1J9T_C;  1MZZ_A;  1MZZ_B;  1MZZ_C;  2DWT_A;  4YSC_A;  4YSC_B;  4YSC_C;  5D4J_A;  5D4J_B;  5D4J_C;  1J9R_A;  1J9R_B;  1J9R_C;  1NDT_A;  2NRD_A;  1AQ8_A;  1AQ8_B;  1AQ8_C;  1WAE_A;  1AS7_A;  1AS7_B;  1AS7_C;  1BQ5_A;  3H4F_A;  3H4F_B;  1NID_A;  1GS6_X;  1RZQ_A;  1RZQ_B;  1RZQ_C;  1NTD_A;  2VN3_A;  2XWZ_A;  2XWZ_B;  2XWZ_C;  2XWZ_D;  2XWZ_E;  2XWZ_F;  2DY2_A;  2JFC_A;  2JFC_B;  2JFC_C;  2JFC_D;  2JFC_E;  2JFC_F;  1NIA_A;  1NIA_B;  1NIA_C;  2VMJ_A;  1NIB_A;  1NIB_B;  1NIB_C;  2AVF_A;  2AVF_B;  2AVF_C;  2AVF_D;  2AVF_E;  2AVF_F;  5B1J_A;  5B1J_B;  2XX1_A;  2XX1_B;  2XX1_C;  2XX1_D;  2XX1_E;  2XX1_F;  1NDR_A;  1NDR_B;  1NDR_C;  1NDS_A;  1NDS_B;  1NDS_C;  6GTJ_A;  2P80_A;  2P80_B;  2P80_C; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling