3HG1DE

Germline-governed recognition of a cancer epitope by an immunodominant human t cell receptor
Link type Probability Chain D piercings Chain E piercings
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
view details
Unlink Unlink 64% +174E -189E -228E +244E +159D -196D
Interpreting sequences
Chain D Sequence
QEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNVAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDT
Chain D Sequence
SQTIHQWPATLVQPVGSPLSLECTVEGTSNPNLYWYRQAAGRGLQLLFYSVGIGQISSEVPQNLSASRPQDRQFILSSKKLLLSDSGFYLCAWSETGLGTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
sequence length 194,244
structure length 194,244
publication title Germ line-governed recognition of a cancer epitope by an immunodominant human T-cell receptor.
pubmed doi rcsb
molecule tags Immune system
molecule keywords MHC class I antigen
source organism Homo sapiens
pdb deposition date2009-05-13
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
DE PF09291 DUF1968Domain of unknown function (DUF1968)
DE PF07654 C1-setImmunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hg1D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hg1D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hg1E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hg1E01
3HPJBDE 1AGBAC 3E2HABQ 1ZLWHLM 3FT3AP 1OP3HKL 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3IXADF 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3GJFDF 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 1AGBABC 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3HAEHL 1A9BBDF 3HPJDEF 1AHWDE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3JTTDEI 3JTTAEI 1ZLUKLM 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HNVHL 1OP3HM 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 1Q8MBC 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 1A1MAC 3E3QeF 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1Q8MCD 3FOMAB 3HPJACE 3H9SACD 3FT4AP 1ZLVHL 2VSCAC 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3H9HABC 1OP5HL 3FONCD 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HAEDFK 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IVKBL 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3EFFAM 3FQRABC 3DX8ABC 3HCVAB 3HAEST 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3DXAAKM 3GJFEH 1A9BAB 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3HAEPQR 3IVKAH 3HG1ABC 1AGFAC 1OP3HLM 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JTTCGH 3GIZHL 3GSWABP 1AGCABC 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 1ZLULM 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3E3QBCG 3FFCACF 3H9HACD 3GSNAB 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3DXAFH 3F7YAB 1OP3HKM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 3E3QADQ 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3HC3HL 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3DX9CD 1OP5KM 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1AIFHL 3HAEJMO 3FCTAB 3JTTAGH 3H7BDF 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1OP5HKLM 3E3QPST 3H9SACE 3HG1ACD 3FFCAC 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3GIVADE 1ZLUHKLM 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 3GSOAB 3FRUAD 1OM3HK 3JTTCDF 1AGFAB 3GJEABL 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3E3QDE 3DXAEJ
chains in the LinkProt database with same CATH superfamily
3HPJBDE 1AGBAC 3H4FABC 3E2HABQ 1ZLWHLM 3KDPABC 1OP3HKL 1SLVAB 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3JWNHLM 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3FT3AP 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3H4HBC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 3JTTDG 3JWNCGK 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FCSBC 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3JWNFIK 3HAEHL 1A9BBDF 3E3QBCG 1AHWDE 1UT1DE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 3HG1ABC 3H9SACE 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3FCSABC 3JTTAEI 1ZLUKLM 1Q8MBC 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HPJDEF 3HNVHL 3JWNIKN 3H4FBC 1OP3HM 3JTTDGH 3JWNFGN 1AGBABC 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 3FONCD 1UT1CF 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 3GEFACD 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3K5SAB 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3GEFAB 3H4HAB 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 3GIVADE 1A1MAC 3E3QeF 1UT1AD 3KDPCDG 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3JWNCFN 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1GMECD 3FOMAB 3KDPABD 3JWNHIL 2W5PAB 3FT4AP 1ZLVHL 2VSCAC 1UT1ADE 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3GEFBCD 1ZXKAB 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3JWNIKL 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3H4FAC 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3GJFDF 3H9HABC 1OP5HL 3GSNAB 3JWNHMN 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HPJACE 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IXADF 3FCSAB 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3JWNEHK 3EFFAM 3FQRABC 3JWNCEH 3DX8ABC 3HCVAB 3HAEST 3JWNCFL 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3JWNGHM 3H9SABC 3FCSAD 3JWNHLN 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3JWNHN 3DXAAKM 3GJFEH 3GEFCD 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FCSBCD 3FQNABC 3GEFABC 3H4HABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3JWNCGH 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3DX7AB 3HAEPQR 3IVKAH 3JWNEHN 1AGFAC 3JWNCEM 3HAEDFM 1A9BACF 3FQTAC 3FCSCD 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3KDPACD 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JWNGH 3JTTCGH 3GIZHL 3GSWABP 3GEFBD 1UT1BF 1AGCABC 1ZVNAB 3FCSABD 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3JWNGN 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3GEFABD 3JWNIK 1ZLULM 3GSRAP 3H7BDEF 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3JWNCEL 3FFCACF 3H9HACD 3DXAACK 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3GEFAD 3F7YAB 1OP3HKM 1OP3HLM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 1Q8MCD 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 1UT1BC 3E3QADQ 3JWNCEK 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3H9SACD 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3KDPABG 3JWNHIK 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3JWNIKM 3HC3HL 3JWNGHI 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3H4FAB 3JWNMN 3DXAFH 3KDPAB 3E3Qcdf 3JWNLMN 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3KDPCD 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 2W5PABC 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3FCSACD 3JWNCGL 3DX9CD 3H4HAC 2W5PBC 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1UT1AE 1AIFHL 3JWNEFH 3FCTAB 3JTTAGH 3JWNGIK 3H7BDF 3GEFBC 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3GEFAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1A9BAB 1OP5HKLM 1OP5KM 3E3QPST 3JWNHIM 3HG1ACD 3FFCAC 1GMEAB 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3JTTDEI 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3KDPBCH 1ZLUHKLM 3FRUEF 1A9BDF 3JWNCE 3FFCACE 3GSWAP 3IXAAD 3IVKBL 3JWNFHL 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3KDPCDH 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 3JWNCGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 1QEXAB 3HAEJMO 3GSOAB 3FRUAD 1OM3HK 1UT1BCF 3HAEDFK 3JTTCDF 1AGFAB 3GJEABL 3JWNCEN 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3JWNCGN 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 2W5PAC 3FCSAC 3KDPABH 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3JWNCEG 3KDPBCG 3E3QDE 3DXAEJ 3JWNGMN 3JWNCFM
chains in the LinkProt database with same CATH topology
3HPJBDE 1AGBAC 3E2HABQ 1ZLWHLM 3FT3AP 1OP3HKL 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3IXADF 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3GJFDF 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 1AGBABC 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3HAEHL 1A9BBDF 3HPJDEF 1AHWDE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3JTTDEI 3JTTAEI 1ZLUKLM 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HNVHL 1OP3HM 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 1Q8MBC 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 1A1MAC 3E3QeF 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1Q8MCD 3FOMAB 3HPJACE 3H9SACD 3FT4AP 1ZLVHL 2VSCAC 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3H9HABC 1OP5HL 3FONCD 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HAEDFK 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IVKBL 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3EFFAM 3FQRABC 3DX8ABC 3HCVAB 3HAEST 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3DXAAKM 3GJFEH 1A9BAB 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3HAEPQR 3IVKAH 3HG1ABC 1AGFAC 1OP3HLM 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JTTCGH 3GIZHL 3GSWABP 1AGCABC 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 1ZLULM 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3E3QBCG 3FFCACF 3H9HACD 3GSNAB 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3DXAFH 3F7YAB 1OP3HKM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 3E3QADQ 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3HC3HL 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3DX9CD 1OP5KM 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1AIFHL 3HAEJMO 3FCTAB 3JTTAGH 3H7BDF 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1OP5HKLM 3E3QPST 3H9SACE 3HG1ACD 3FFCAC 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3GIVADE 1ZLUHKLM 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 3GSOAB 3FRUAD 1OM3HK 3JTTCDF 1AGFAB 3GJEABL 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3E3QDE 3DXAEJ
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  1ZLW HLM;  3FT3 AP;  1OP3 HKL;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3IXA DF;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3GJF DF;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3HAE HL;  1A9B BDF;  3HPJ DEF;  1AHW DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3JTT DEI;  3JTT AEI;  1ZLU KLM;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HNV HL;  1OP3 HM;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  1Q8M BC;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  1A1M AC;  3E3Q eF;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1Q8M CD;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  1ZLV HL;  2VSC AC;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3H9H ABC;  1OP5 HL;  3FON CD;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HAE DFK;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IVK BL;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3EFF AM;  3FQR ABC;  3DX8 ABC;  3HCV AB;  3HAE ST;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3DXA AKM;  3GJF EH;  1A9B AB;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3HAE PQR;  3IVK AH;  3HG1 ABC;  1AGF AC;  1OP3 HLM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JTT CGH;  3GIZ HL;  3GSW ABP;  1AGC ABC;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  1ZLU LM;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3E3Q BCG;  3FFC ACF;  3H9H ACD;  3GSN AB;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3DXA FH;  3F7Y AB;  1OP3 HKM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  3E3Q ADQ;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3HC3 HL;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3DX9 CD;  1OP5 KM;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1AIF HL;  3HAE JMO;  3FCT AB;  3JTT AGH;  3H7B DF;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1OP5 HKLM;  3E3Q PST;  3H9S ACE;  3HG1 ACD;  3FFC AC;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3GIV ADE;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  3GSO AB;  3FRU AD;  1OM3 HK;  3JTT CDF;  1AGF AB;  3GJE ABL;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3E3Q DE;  3DXA EJ; 
#chains in the LinkProt database with same CATH topology
 3HPJ BDE;  1AGB AC;  3H4F ABC;  3E2H ABQ;  1ZLW HLM;  3KDP ABC;  1OP3 HKL;  1SLV AB;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3JWN HLM;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3FT3 AP;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3H4H BC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  3JTT DG;  3JWN CGK;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FCS BC;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3JWN FIK;  3HAE HL;  1A9B BDF;  3E3Q BCG;  1AHW DE;  1UT1 DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  3HG1 ABC;  3H9S ACE;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3FCS ABC;  3JTT AEI;  1ZLU KLM;  1Q8M BC;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HPJ DEF;  3HNV HL;  3JWN IKN;  3H4F BC;  1OP3 HM;  3JTT DGH;  3JWN FGN;  1AGB ABC;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  3FON CD;  1UT1 CF;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  3GEF ACD;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3K5S AB;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3GEF AB;  3H4H AB;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  3GIV ADE;  1A1M AC;  3E3Q eF;  1UT1 AD;  3KDP CDG;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3JWN CFN;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1GME CD;  3FOM AB;  3KDP ABD;  3JWN HIL;  2W5P AB;  3FT4 AP;  1ZLV HL;  2VSC AC;  1UT1 ADE;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3GEF BCD;  1ZXK AB;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3JWN IKL;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3H4F AC;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3GJF DF;  3H9H ABC;  1OP5 HL;  3GSN AB;  3JWN HMN;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HPJ ACE;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IXA DF;  3FCS AB;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3JWN EHK;  3EFF AM;  3FQR ABC;  3JWN CEH;  3DX8 ABC;  3HCV AB;  3HAE ST;  3JWN CFL;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3JWN GHM;  3H9S ABC;  3FCS AD;  3JWN HLN;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3JWN HN;  3DXA AKM;  3GJF EH;  3GEF CD;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FCS BCD;  3FQN ABC;  3GEF ABC;  3H4H ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3JWN CGH;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3DX7 AB;  3HAE PQR;  3IVK AH;  3JWN EHN;  1AGF AC;  3JWN CEM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3FCS CD;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3KDP ACD;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JWN GH;  3JTT CGH;  3GIZ HL;  3GSW ABP;  3GEF BD;  1UT1 BF;  1AGC ABC;  1ZVN AB;  3FCS ABD;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3JWN GN;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3GEF ABD;  3JWN IK;  1ZLU LM;  3GSR AP;  3H7B DEF;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3JWN CEL;  3FFC ACF;  3H9H ACD;  3DXA ACK;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3GEF AD;  3F7Y AB;  1OP3 HKM;  1OP3 HLM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  1Q8M CD;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  1UT1 BC;  3E3Q ADQ;  3JWN CEK;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3H9S ACD;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3KDP ABG;  3JWN HIK;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3JWN IKM;  3HC3 HL;  3JWN GHI;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3H4F AB;  3JWN MN;  3DXA FH;  3KDP AB;  3E3Q cdf;  3JWN LMN;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3KDP CD;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  2W5P ABC;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3FCS ACD;  3JWN CGL;  3DX9 CD;  3H4H AC;  2W5P BC;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1UT1 AE;  1AIF HL;  3JWN EFH;  3FCT AB;  3JTT AGH;  3JWN GIK;  3H7B DF;  3GEF BC;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3GEF AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1A9B AB;  1OP5 HKLM;  1OP5 KM;  3E3Q PST;  3JWN HIM;  3HG1 ACD;  3FFC AC;  1GME AB;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3JTT DEI;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3KDP BCH;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3JWN CE;  3FFC ACE;  3GSW AP;  3IXA AD;  3IVK BL;  3JWN FHL;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3KDP CDH;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  3JWN CGI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  1QEX AB;  3HAE JMO;  3GSO AB;  3FRU AD;  1OM3 HK;  1UT1 BCF;  3HAE DFK;  3JTT CDF;  1AGF AB;  3GJE ABL;  3JWN CEN;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3JWN CGN;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  2W5P AC;  3FCS AC;  3KDP ABH;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3JWN CEG;  3KDP BCG;  3E3Q DE;  3DXA EJ;  3JWN GMN;  3JWN CFM; 
#chains in the LinkProt database with same CATH homology
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  1ZLW HLM;  3FT3 AP;  1OP3 HKL;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3IXA DF;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3GJF DF;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3HAE HL;  1A9B BDF;  3HPJ DEF;  1AHW DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3JTT DEI;  3JTT AEI;  1ZLU KLM;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HNV HL;  1OP3 HM;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  1Q8M BC;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  1A1M AC;  3E3Q eF;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1Q8M CD;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  1ZLV HL;  2VSC AC;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3H9H ABC;  1OP5 HL;  3FON CD;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HAE DFK;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IVK BL;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3EFF AM;  3FQR ABC;  3DX8 ABC;  3HCV AB;  3HAE ST;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3DXA AKM;  3GJF EH;  1A9B AB;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3HAE PQR;  3IVK AH;  3HG1 ABC;  1AGF AC;  1OP3 HLM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JTT CGH;  3GIZ HL;  3GSW ABP;  1AGC ABC;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  1ZLU LM;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3E3Q BCG;  3FFC ACF;  3H9H ACD;  3GSN AB;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3DXA FH;  3F7Y AB;  1OP3 HKM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  3E3Q ADQ;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3HC3 HL;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3DX9 CD;  1OP5 KM;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1AIF HL;  3HAE JMO;  3FCT AB;  3JTT AGH;  3H7B DF;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1OP5 HKLM;  3E3Q PST;  3H9S ACE;  3HG1 ACD;  3FFC AC;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3GIV ADE;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  3GSO AB;  3FRU AD;  1OM3 HK;  3JTT CDF;  1AGF AB;  3GJE ABL;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3E3Q DE;  3DXA EJ; 

6EH4D 6FR4A 6EH5A 4UDTA 6FR3A 6FR5A 4WW1A 2NW2A 6AT6A 1OGAD 2BNUA 6FUNA 1KGCD 6FRCA 6FUQA 6FR9A 6FUOA 4EI6A 4EI6C 6BJ8D 6DFVA 6DFVC 6MRAA 6FUPA 5TEZI 4DZBA 6PUGD 6PUGG 6OVNA 6PUDD 6PUDG 6FURA 6FURC 6PULB 6PULD 6FUMA 6CPHD 5M02G 6PUCD 6PUCG 6FRAA 6PUHB 6PUHD 6EH6A 6W9UD 6W9UG 2BNQD 4WNQA 4WNQC 6FRBA 5D7KD 6PUJB 6PUJD 6PUMD 6PUMG 6VTCA 3VXSD 6PUIB 6PUID 6W9VD 6W9VG 2P5ED 4L4VD 4L4VG 5U6QB 5U6QD 6EH7A 6PUFD 6PUFG 4PJEE 4PJEG 6G9QG 6PVCE 6PVCG 6BJ3D 4MS8C 4G9FD 6MJJC 4PJHE 4PJHG 5KSAC 5D7JA 5D7JG 4PJ9C 6PUED 6PUEG 5U16E 5U16G 5D7IE 5D7IG 6R0EDDD 4PJ5D 4PJ5G 5C0CD 5C0CI 5M01G 6MJ4C 4L4TD 4L4TG 5EU6D 5M00G 6ULND 2IALA 2IALC 6DFXG 6DFXI 6CW9C 2F53D 6PUKB 6PUKD 6TMOD 6MIVC 5ISZD 3QJHA 3QJHC 5C0BD 5C0BI 5YXNA 3MFFA 3MFFC 6PVDD 6PVDG 2VLMD 2BNRD 5IVXE 5NMDA 5NMDC 4NQED 4NQEG 6OMGC 6CUHA 6AVFA 4X6BA 4X6BC 4ELKA 4ELKC 2P5WD 4ZDHA 6AMUD 5U17B 5U17D 5D5ME 5D5MG 5C07D 5C07I 1LP9E 1LP9L 6CXEC 4P23A 3VXQA 3VXQD 5U2VE 5U2VG 4PJXE 4PJXG 3MV7D 5D2NC 5D2ND 4G8FA 4NQDD 4NQDG 3QEUA 3QEUD 3TJHC 4GRMA 4GRMC 5WLGD 5WLGI 4MAYC 3QUYC 2CDFA 2XNAA 3QH3A 3QH3C 6CWEC 6V1AD 4PJGE 4PJGG 5EUOE 5EUOG 3MV8D 6MJIC 3RUGE 3RUGG 2PYFA 3QUZC 6BGAC 4Y19D 2PYED 2EYSA 4LCWD 4LCWG 4G8GD 4NQCD 4NQCG 4PJCE 4PJCG 6V18D 6CX9C 4JRXD 4PJFE 4PJFG 6CUGD 6MJAC 6VM8D 4PJ7E 4PJ7G 5U72B 5U72D 6OVOA 3REVA 6D78D 5C08D 5C08I 6R2LD 4PRPD 6MJ6C 2VLJD 3QFJD 3VXRD 6AM5D 4JFHD 6L9LC 6L9LG 2VLRD 2VLRI 5C0AD 5C0AI 6FR7A 5BS0D 4G8EA 2XN9A 4PJIE 4PJIG 6VTHA 6VTHD 6VRND 6C61A 1J8HD 4WW2A 3QJFA 3QJFC 4WO4C 4PRID 5FKAA 4JFDD 4PJAE 4PJAG 6BNLC 6BNLG 6CQND 5JHDD 5JHDI 6CXFC 6CX5C 5JZID 5JZII 4JFFD 5C09D 5C09I 6FR8A 3W0WD 6CQLD 2YPLD 4P2OC 5KS9E 5KS9G 1TCRA 3QDJD 5WJOA 5WJOC 4Z7UE 4Z7UG 4PJDE 4PJDG 6AVGB 6AVGC 2GJ6D 4Z7VE 4Z7VG 6VRMD 3VXMD 3QI9C 3UTTD 3UTTI 4PRHD 2EYRA 5BRZD 4OZFG 4E41D 4E41I 4PJBE 4PJBG 6C68A 6C68C 6V19D 3HUJE 3HUJG 5U1RB 5U1RD 5HHMD 5HHMI 6CXAC 2VLKD 4X6CE 4X6CG 4EN3A 6XQQA 6XQQC 6CX7C 2EYTA 2EYTC 1MI5D 2UWEE 2UWEL 3KPSD 4MXQC 4Y16C 6EH8A 3PWPD 3VXTA 3VXTC 6EQBD 6MIYC 6MIYG 3O4LD 6VQOD 6VQOH 6Q3SD 3QEQD 5XOVG 5XOVI 4GKZA 3O8XC 4E42A 4E42C 2ESVD 6EH9A 4P46A 4JFED 5NMGD 5NMGI 4IRSC 3UTSD 3UTSI 1FYTD 6DFQA 6DFQC 6DFQE 6DFQG 6C09C 5MEND 3TA3C 3KPRD 3KPRI 2CDGA 3RDTA 1BD2D 4L3ED 3PL6C 3O9WC 6V15D 4JRYD 5XOTD 3DX9A 3DX9C 2JCCE 2JCCL 3UTPD 3UTPK 4X6DE 4X6DG 3D39D 3ARBC 3QIUC 4UDUA 4APQC 2AK4D 2AK4I 2AK4N 2AK4T 6V13D 6XQPE 6XQPG 3QDGD 4P4KC 4P4KG 5SWZD 5SWZI 5SWZN 5SWZS 5NMFD 5NMFI 6RPBD 6RPBI 6RPBN 6RPBS 5WKID 4N0CC 4N0CG 3H9SD 6V0YD 6UK4D 3QIBC 6CQQD 6CQQI 6MSSA 4MNQD 4FTVD 3VWKC 2IAMC 3C5ZA 3C5ZE 5WKFD 5WKFI 3SKNA 3SKNC 3SKNE 3SKNG 2F54D 2F54K 4IRJC 4GRLC 6MNGA 3QDMD 1QRND 6CW6C 5NMED 5NMEI 3RGVA 1AO7D 6RPAD 4PJ8C 3D3VD 6PY2D 3TYFA 3TYFC 4QRPD 4QRPJ 4QRPK 4ZAKC 4Y4KC 3AREC 3FFCD 3FFCI 3QUXC 4IIQA 6CWBC 6P64D 6P64I 5WKHD 5WKHI 5YXUA 5YXUF 3MV9D 2IAND 2IANI 2IANN 2IANS 6MNNA 4N5EC 1MWAA 1MWAC 5TILG 3HE7C 3TVMC 3TVMG 6FR6A 4OZHE 4OZHG 4OZGE 4OZGG 3RTQC 4QOKD 6EQAD 6PX6D 3SCMC 6MNOA 5VCJC 4WWKA 5KSBE 5KSBG 4EI5C 4EI5G 4QRRD 3GSNA 3RZCC 3O6FC 3O6FG 4P5TA 4P5TE 3ARFC 6TROD 4Z7WE 4Z7WG 5SWSD 6MJQC 6MJQG 3ARDC 4L8SA 4NHUA 4NHUC 1QSED 1NFDA 1NFDC 3TFKC 4P2QD 4P2QI 4P2QN 4P2QS 2CKBA 2CKBC 1QSFD 4C56A 4C56G 5HYJD 5HYJI 6BNKC 6BNKG 6MTMD 4Y2DC 4Y2DG 4EUPG 4EUPI 3HE6C 6DKPD 5W1WD 5W1WI 5W1WN 5W1WS 3KXFD 3KXFG 3KXFM 3KXFN 6CQRD 6CQRI 3TO4C 5HHOD 6VMXD 6VMXI 6MNMA 2NX5D 2NX5I 2NX5N 2NX5T 4OZIE 4OZIG 3VXUD 3VXUI 3ARGC 6RP9D 6RP9I 6RP9K 5NHTA 4Y4FC 4Y4FG 5L2KD 3VWJC 4MVBC 3TPUA 3TPUC 3TPUG 3TPUM 5IW1A 5IW1C 5IW1E 4P2RD 4P2RI 4P2RN 4P2RS 4MJID 4MJII 6ULRD 4NDMB 3TZVA 3TZVG 3QIWC 3AXLA 3AXLG 6UK2D 3SDXE 3SDXG 6RSYD 6RSYI 2WBJC 2WBJG 3TN0C 2PO6C 2PO6G 3SDAC 6DFSA 5TJEE 5TJEG 3SDCC 5NQKA 4Y4HC 4Y4HG 2J8UE 2J8UL 6MKDA 6V80C 6V80H 1ZGLM 1ZGLQ 1ZGLS 1ZGLU 6DFWE 6DFWG 4ELME 4ELMG 5W1VD 5W1VI 5W1VN 5W1VS 4ONHA 3SDDC 4MNHB 4MNHD 6MKRA 3SJVD 3SJVI 3SJVN 3SJVS 4GG6E 4GG6G 3PQYD 3PQYI 3PQYN 3PQYS 5FK9A 3C60A 3C60E 1G6RA 1G6RC 6BJ2D 4GG8A 4GG8E 4LCCA 4L9LA 6UONG 6UONI 1YPZE 1YPZG 3C6LA 3C6LE 4Y1AD 5D7LD 5D7LG 5D2LE 5D2LI 5D2LK 5D2LO 1YMMD 3T0EC 2CDEA 2CDEC 2CDEE 3DXAD 3DXAI 3DXAN 5E6IA 5E6IF 5E6IG 5E6IP 6U3ND 6U3OA 6U3OG 6EH4E 6FR4B 6EH5B 4UDTB 6FR3B 6FR5B 4WW1B 2NW2B 6AT6B 1OGAE 2BNUB 6FUNB 1KGCE 6FRCB 6FUQB 6FR9B 6FUOB 4EI6B 4EI6D 6BJ8H 6DFVB 6DFVD 6MRAB 6FUPB 5TEZJ 4DZBB 6PUGE 6PUGH 6OVNB 1BECA 6PUDE 6PUDH 6FURB 6FURD 6PULE 6PULG 6FUMB 6CPHE 5M02H 6PUCE 6PUCH 6FRAB 6PUHE 6PUHG 6EH6B 6W9UE 6W9UH 2BNQE 4WNQB 4WNQD 2Q86B 2Q86D 6FRBB 5D7KE 6PUJE 6PUJG 6PUME 6PUMH 6VTCB 3VXSE 6PUIE 6PUIG 6W9VE 6W9VH 2P5EE 4L4VE 4L4VH 3Q5YA 3Q5YB 3Q5YC 3Q5YD 5U6QE 5U6QG 6EH7B 6PUFE 6PUFH 4PJEF 4PJEH 6G9QH 6PVCF 6PVCH 6BJ3H 4MS8D 4G9FE 6MJJD 4PJHF 4PJHH 5KSAD 5D7JB 5D7JH 4PJ9D 6PUEE 6PUEH 5U16F 5U16H 5D7IF 5D7IH 6R0EEEE 4PJ5E 4PJ5H 5C0CE 5C0CJ 5M01H 6MJ4D 4L4TE 4L4TH 5EU6E 5M00H 6ULNE 2IALB 2IALD 6DFXH 6DFXJ 6CW9D 2F53E 6PUKE 6PUKG 6TMOE 6MIVD 5ISZE 3QJHB 3QJHD 5C0BE 5C0BJ 5YXNB 3MFFB 3MFFD 6PVDE 6PVDH 2VLME 2BNRE 5IVXF 5NMDB 5NMDD 4NQEE 4NQEH 6OMGD 6CUHB 6AVFB 4X6BB 4X6BD 4ELKB 4ELKD 2P5WE 4ZDHB 6AMUE 5U17E 5U17G 5D5MF 5D5MH 5C07E 5C07J 1LP9F 1LP9M 6CXED 4P23B 3VXQB 3VXQE 5U2VF 5U2VH 4PJXF 4PJXH 3MV7E 5D2NE 5D2NF 4G8FB 4NQDE 4NQDH 3QEUB 3QEUE 3TJHD 4GRMB 4GRMD 3Q5TA 5WLGE 5WLGJ 4MAYD 3QUYD 2CDFB 2XNAB 3QH3B 3QH3D 6CWED 6V1AE 4PJGF 4PJGH 5EUOF 5EUOH 3MV8E 6MJID 3RUGF 3RUGH 2PYFB 3QUZD 6BGAD 4Y19E 2PYEE 2EYSB 4LCWE 4LCWH 4G8GE 4NQCE 4NQCH 4PJCF 4PJCH 6V18E 6CX9D 4JRXE 4PJFF 4PJFH 6CUGE 6MJAD 6VM8E 4PJ7F 4PJ7H 5U72E 5U72G 6OVOB 3REVB 6D78E 5C08E 5C08J 6R2LE 4PRPE 6MJ6D 2VLJE 3QFJE 3VXRE 6AM5E 4JFHE 6L9LD 6L9LH 2VLRE 2VLRJ 5C0AE 5C0AJ 6FR7B 5BS0E 4G8EB 2XN9B 4PJIF 4PJIH 6VTHB 6VTHE 6VRNE 6C61B 1J8HE 4WW2B 3QJFB 3QJFD 4WO4D 4PRIE 5FKAB 4JFDE 4PJAF 4PJAH 6BNLD 6BNLH 6CQNE 5JHDE 5JHDJ 6CXFD 6CX5D 5JZIE 5JZIJ 4JFFE 2NTSP 5C09E 5C09J 6FR8B 3W0WE 6CQLE 2YPLE 4P2OD 5KS9F 5KS9H 1TCRB 3QDJE 5WJOB 5WJOD 4Z7UF 4Z7UH 4PJDF 4PJDH 6AVGD 6AVGE 1SBBA 1SBBC 2GJ6E 4Z7VF 4Z7VH 6VRME 3VXME 3QI9D 3UTTE 3UTTJ 4PRHE 2EYRB 5BRZE 4OZFH 4E41E 4E41J 4PJBF 4PJBH 6C68B 6C68D 6V19E 3HUJF 3HUJH 5U1RE 5U1RG 5HHME 5HHMJ 6CXAD 2VLKE 1L0YA 1L0YC 4X6CF 4X6CH 3OF6A 3OF6B 3OF6C 4EN3B 6XQQB 6XQQD 6CX7D 2EYTB 2EYTD 1MI5E 2UWEF 2UWEM 3KPSE 4MXQD 4Y16D 6EH8B 3PWPE 3VXTB 3VXTD 6EQBE 6MIYD 6MIYH 3O4LE 6VQOE 6VQOJ 6Q3SE 3QEQE 5XOVH 5XOVJ 4GKZB 3O8XD 4E42B 4E42D 2ESVE 6EH9B 4P46B 4JFEE 5NMGE 5NMGJ 4IRSD 3UTSE 3UTSJ 1FYTE 6DFQB 6DFQD 6DFQF 6DFQH 6C09D 5MENE 3TA3D 3KPRE 3KPRJ 2CDGB 3RDTB 1BD2E 4L3EE 3PL6D 3O9WD 6V15E 4JRYE 5XOTE 3DX9B 3DX9D 2JCCF 2JCCM 3UTPE 3UTPL 4X6DF 4X6DH 3D39E 3ARBD 3QIUD 4UDUB 4APQD 2AK4E 2AK4J 2AK4P 2AK4U 6V13E 6XQPF 6XQPH 3QDGE 4P4KD 4P4KH 5SWZE 5SWZJ 5SWZO 5SWZT 5NMFE 5NMFJ 6RPBE 6RPBJ 6RPBO 6RPBT 5WKIE 4N0CD 4N0CH 3H9SE 6V0YE 6UK4E 3QIBD 6CQQE 6CQQJ 6MSSB 4MNQE 4FTVE 3VWKD 2IAMD 3C5ZB 3C5ZF 5WKFE 5WKFJ 3SKNB 3SKND 3SKNF 3SKNH 2F54E 2F54L 4IRJD 4GRLD 2AXJA 2AXJB 6MNGB 3QDME 1QRNE 6CW6D 5NMEE 5NMEJ 3RGVB 1AO7E 6RPAE 4PJ8D 3D3VE 6PY2E 3TYFB 3TYFD 4QRPE 4QRPI 4QRPL 4ZAKD 4Y4KD 3ARED 3FFCE 3FFCJ 3QUXD 4IIQB 2AXHA 2AXHB 6CWBD 6P64E 6P64J 5WKHE 5WKHJ 5YXUB 5YXUG 3MV9E 2IANE 2IANJ 2IANO 2IANT 6MNNB 4N5ED 1MWAB 1MWAD 5TILH 5TILL 3HE7D 3TVMD 3TVMH 6FR6B 4OZHF 4OZHH 4OZGF 4OZGH 3RTQD 4QOKE 6EQAE 6PX6E 1L0XA 1L0XC 3SCMD 6MNOB 5VCJD 4WWKB 5KSBF 5KSBH 4EI5D 4EI5H 4QRRE 3GSNB 3RZCD 3O6FD 3O6FH 4P5TB 4P5TF 3ARFD 6TROE 4Z7WF 4Z7WH 5SWSE 6MJQD 6MJQH 3ARDD 4L8SB 4NHUB 4NHUD 1QSEE 1NFDB 1NFDD 3TFKD 4P2QE 4P2QJ 4P2QO 4P2QT 2CKBB 2CKBD 1QSFE 4C56B 4C56H 5HYJE 5HYJJ 6BNKD 6BNKH 6MTME 4Y2DD 4Y2DH 4EUPH 4EUPJ 3HE6D 6DKPE 5W1WE 5W1WJ 5W1WO 5W1WT 3KXFE 3KXFH 3KXFO 3KXFP 6CQRE 6CQRJ 3TO4D 5HHOE 6VMXE 6VMXJ 6MNMB 2NX5E 2NX5J 2NX5P 2NX5U 4OZIF 4OZIH 3VXUE 3VXUJ 3ARGD 6RP9E 6RP9J 6RP9L 5NHTB 4Y4FD 4Y4FH 5L2KE 3MBED 3MBEH 3VWJD 4MVBD 3TPUB 3TPUD 3TPUH 3TPUN 5IW1B 5IW1D 5IW1F 4P2RE 4P2RJ 4P2RO 4P2RT 4MJIE 4MJIJ 6ULRE 4NDMA 3TZVB 3TZVH 3QIWD 3AXLB 3AXLH 6UK2E 3SDXF 3SDXH 6RSYE 6RSYJ 2WBJD 2WBJH 3TN0D 2PO6D 2PO6H 3SDAD 6DFSB 5TJEF 5TJEH 3SDCD 5NQKB 4Y4HD 4Y4HH 2J8UF 2J8UM 6MKDB 6V80D 6V80I 1ZGLP 1ZGLR 1ZGLT 1ZGLV 6DFWF 6DFWH 4ELMF 4ELMH 5W1VE 5W1VJ 5W1VO 5W1VT 4ONHB 3SDDD 4MNHA 4MNHC 6MKRB 3SJVE 3SJVJ 3SJVO 3SJVT 4GG6F 4GG6H 3PQYE 3PQYJ 3PQYO 3PQYT 5FK9B 3C60B 3C60F 1G6RB 1G6RD 6BJ2E 1JCKA 1JCKC 4GG8B 4GG8F 4LCCB 4L9LB 6UONH 6UONJ 3C6LB 3C6LF 4Y1AE 5D7LE 5D7LH 5D2LF 5D2LJ 5D2LL 5D2LP 1YMME 3T0ED 1KTKE 1KTKF 2CDEB 2CDED 2CDEF 3DXAE 3DXAJ 3DXAO 5E6IB 5E6IH 5E6IL 5E6IQ 6U3NE 6U3OB 6U3OH
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6EH4_D;  6FR4_A;  6EH5_A;  4UDT_A;  6FR3_A;  6FR5_A;  4WW1_A;  2NW2_A;  6AT6_A;  1OGA_D;  2BNU_A;  6FUN_A;  1KGC_D;  6FRC_A;  6FUQ_A;  6FR9_A;  6FUO_A;  4EI6_A;  4EI6_C;  6BJ8_D;  6DFV_A;  6DFV_C;  6MRA_A;  6FUP_A;  5TEZ_I;  4DZB_A;  6PUG_D;  6PUG_G;  6OVN_A;  6PUD_D;  6PUD_G;  6FUR_A;  6FUR_C;  6PUL_B;  6PUL_D;  6FUM_A;  6CPH_D;  5M02_G;  6PUC_D;  6PUC_G;  6FRA_A;  6PUH_B;  6PUH_D;  6EH6_A;  6W9U_D;  6W9U_G;  2BNQ_D;  4WNQ_A;  4WNQ_C;  6FRB_A;  5D7K_D;  6PUJ_B;  6PUJ_D;  6PUM_D;  6PUM_G;  6VTC_A;  3VXS_D;  6PUI_B;  6PUI_D;  6W9V_D;  6W9V_G;  2P5E_D;  4L4V_D;  4L4V_G;  5U6Q_B;  5U6Q_D;  6EH7_A;  6PUF_D;  6PUF_G;  4PJE_E;  4PJE_G;  6G9Q_G;  6PVC_E;  6PVC_G;  6BJ3_D;  4MS8_C;  4G9F_D;  6MJJ_C;  4PJH_E;  4PJH_G;  5KSA_C;  5D7J_A;  5D7J_G;  4PJ9_C;  6PUE_D;  6PUE_G;  5U16_E;  5U16_G;  5D7I_E;  5D7I_G;  6R0E_DDD;  4PJ5_D;  4PJ5_G;  5C0C_D;  5C0C_I;  5M01_G;  6MJ4_C;  4L4T_D;  4L4T_G;  5EU6_D;  5M00_G;  6ULN_D;  2IAL_A;  2IAL_C;  6DFX_G;  6DFX_I;  6CW9_C;  2F53_D;  6PUK_B;  6PUK_D;  6TMO_D;  6MIV_C;  5ISZ_D;  3QJH_A;  3QJH_C;  5C0B_D;  5C0B_I;  5YXN_A;  3MFF_A;  3MFF_C;  6PVD_D;  6PVD_G;  2VLM_D;  2BNR_D;  5IVX_E;  5NMD_A;  5NMD_C;  4NQE_D;  4NQE_G;  6OMG_C;  6CUH_A;  6AVF_A;  4X6B_A;  4X6B_C;  4ELK_A;  4ELK_C;  2P5W_D;  4ZDH_A;  6AMU_D;  5U17_B;  5U17_D;  5D5M_E;  5D5M_G;  5C07_D;  5C07_I;  1LP9_E;  1LP9_L;  6CXE_C;  4P23_A;  3VXQ_A;  3VXQ_D;  5U2V_E;  5U2V_G;  4PJX_E;  4PJX_G;  3MV7_D;  5D2N_C;  5D2N_D;  4G8F_A;  4NQD_D;  4NQD_G;  3QEU_A;  3QEU_D;  3TJH_C;  4GRM_A;  4GRM_C;  5WLG_D;  5WLG_I;  4MAY_C;  3QUY_C;  2CDF_A;  2XNA_A;  3QH3_A;  3QH3_C;  6CWE_C;  6V1A_D;  4PJG_E;  4PJG_G;  5EUO_E;  5EUO_G;  3MV8_D;  6MJI_C;  3RUG_E;  3RUG_G;  2PYF_A;  3QUZ_C;  6BGA_C;  4Y19_D;  2PYE_D;  2EYS_A;  4LCW_D;  4LCW_G;  4G8G_D;  4NQC_D;  4NQC_G;  4PJC_E;  4PJC_G;  6V18_D;  6CX9_C;  4JRX_D;  4PJF_E;  4PJF_G;  6CUG_D;  6MJA_C;  6VM8_D;  4PJ7_E;  4PJ7_G;  5U72_B;  5U72_D;  6OVO_A;  3REV_A;  6D78_D;  5C08_D;  5C08_I;  6R2L_D;  4PRP_D;  6MJ6_C;  2VLJ_D;  3QFJ_D;  3VXR_D;  6AM5_D;  4JFH_D;  6L9L_C;  6L9L_G;  2VLR_D;  2VLR_I;  5C0A_D;  5C0A_I;  6FR7_A;  5BS0_D;  4G8E_A;  2XN9_A;  4PJI_E;  4PJI_G;  6VTH_A;  6VTH_D;  6VRN_D;  6C61_A;  1J8H_D;  4WW2_A;  3QJF_A;  3QJF_C;  4WO4_C;  4PRI_D;  5FKA_A;  4JFD_D;  4PJA_E;  4PJA_G;  6BNL_C;  6BNL_G;  6CQN_D;  5JHD_D;  5JHD_I;  6CXF_C;  6CX5_C;  5JZI_D;  5JZI_I;  4JFF_D;  5C09_D;  5C09_I;  6FR8_A;  3W0W_D;  6CQL_D;  2YPL_D;  4P2O_C;  5KS9_E;  5KS9_G;  1TCR_A;  3QDJ_D;  5WJO_A;  5WJO_C;  4Z7U_E;  4Z7U_G;  4PJD_E;  4PJD_G;  6AVG_B;  6AVG_C;  2GJ6_D;  4Z7V_E;  4Z7V_G;  6VRM_D;  3VXM_D;  3QI9_C;  3UTT_D;  3UTT_I;  4PRH_D;  2EYR_A;  5BRZ_D;  4OZF_G;  4E41_D;  4E41_I;  4PJB_E;  4PJB_G;  6C68_A;  6C68_C;  6V19_D;  3HUJ_E;  3HUJ_G;  5U1R_B;  5U1R_D;  5HHM_D;  5HHM_I;  6CXA_C;  2VLK_D;  4X6C_E;  4X6C_G;  4EN3_A;  6XQQ_A;  6XQQ_C;  6CX7_C;  2EYT_A;  2EYT_C;  1MI5_D;  2UWE_E;  2UWE_L;  3KPS_D;  4MXQ_C;  4Y16_C;  6EH8_A;  3PWP_D;  3VXT_A;  3VXT_C;  6EQB_D;  6MIY_C;  6MIY_G;  3O4L_D;  6VQO_D;  6VQO_H;  6Q3S_D;  3QEQ_D;  5XOV_G;  5XOV_I;  4GKZ_A;  3O8X_C;  4E42_A;  4E42_C;  2ESV_D;  6EH9_A;  4P46_A;  4JFE_D;  5NMG_D;  5NMG_I;  4IRS_C;  3UTS_D;  3UTS_I;  1FYT_D;  6DFQ_A;  6DFQ_C;  6DFQ_E;  6DFQ_G;  6C09_C;  5MEN_D;  3TA3_C;  3KPR_D;  3KPR_I;  2CDG_A;  3RDT_A;  1BD2_D;  4L3E_D;  3PL6_C;  3O9W_C;  6V15_D;  4JRY_D;  5XOT_D;  3DX9_A;  3DX9_C;  2JCC_E;  2JCC_L;  3UTP_D;  3UTP_K;  4X6D_E;  4X6D_G;  3D39_D;  3ARB_C;  3QIU_C;  4UDU_A;  4APQ_C;  2AK4_D;  2AK4_I;  2AK4_N;  2AK4_T;  6V13_D;  6XQP_E;  6XQP_G;  3QDG_D;  4P4K_C;  4P4K_G;  5SWZ_D;  5SWZ_I;  5SWZ_N;  5SWZ_S;  5NMF_D;  5NMF_I;  6RPB_D;  6RPB_I;  6RPB_N;  6RPB_S;  5WKI_D;  4N0C_C;  4N0C_G;  3H9S_D;  6V0Y_D;  6UK4_D;  3QIB_C;  6CQQ_D;  6CQQ_I;  6MSS_A;  4MNQ_D;  4FTV_D;  3VWK_C;  2IAM_C;  3C5Z_A;  3C5Z_E;  5WKF_D;  5WKF_I;  3SKN_A;  3SKN_C;  3SKN_E;  3SKN_G;  2F54_D;  2F54_K;  4IRJ_C;  4GRL_C;  6MNG_A;  3QDM_D;  1QRN_D;  6CW6_C;  5NME_D;  5NME_I;  3RGV_A;  1AO7_D;  6RPA_D;  4PJ8_C;  3D3V_D;  6PY2_D;  3TYF_A;  3TYF_C;  4QRP_D;  4QRP_J;  4QRP_K;  4ZAK_C;  4Y4K_C;  3ARE_C;  3FFC_D;  3FFC_I;  3QUX_C;  4IIQ_A;  6CWB_C;  6P64_D;  6P64_I;  5WKH_D;  5WKH_I;  5YXU_A;  5YXU_F;  3MV9_D;  2IAN_D;  2IAN_I;  2IAN_N;  2IAN_S;  6MNN_A;  4N5E_C;  1MWA_A;  1MWA_C;  5TIL_G;  3HE7_C;  3TVM_C;  3TVM_G;  6FR6_A;  4OZH_E;  4OZH_G;  4OZG_E;  4OZG_G;  3RTQ_C;  4QOK_D;  6EQA_D;  6PX6_D;  3SCM_C;  6MNO_A;  5VCJ_C;  4WWK_A;  5KSB_E;  5KSB_G;  4EI5_C;  4EI5_G;  4QRR_D;  3GSN_A;  3RZC_C;  3O6F_C;  3O6F_G;  4P5T_A;  4P5T_E;  3ARF_C;  6TRO_D;  4Z7W_E;  4Z7W_G;  5SWS_D;  6MJQ_C;  6MJQ_G;  3ARD_C;  4L8S_A;  4NHU_A;  4NHU_C;  1QSE_D;  1NFD_A;  1NFD_C;  3TFK_C;  4P2Q_D;  4P2Q_I;  4P2Q_N;  4P2Q_S;  2CKB_A;  2CKB_C;  1QSF_D;  4C56_A;  4C56_G;  5HYJ_D;  5HYJ_I;  6BNK_C;  6BNK_G;  6MTM_D;  4Y2D_C;  4Y2D_G;  4EUP_G;  4EUP_I;  3HE6_C;  6DKP_D;  5W1W_D;  5W1W_I;  5W1W_N;  5W1W_S;  3KXF_D;  3KXF_G;  3KXF_M;  3KXF_N;  6CQR_D;  6CQR_I;  3TO4_C;  5HHO_D;  6VMX_D;  6VMX_I;  6MNM_A;  2NX5_D;  2NX5_I;  2NX5_N;  2NX5_T;  4OZI_E;  4OZI_G;  3VXU_D;  3VXU_I;  3ARG_C;  6RP9_D;  6RP9_I;  6RP9_K;  5NHT_A;  4Y4F_C;  4Y4F_G;  5L2K_D;  3VWJ_C;  4MVB_C;  3TPU_A;  3TPU_C;  3TPU_G;  3TPU_M;  5IW1_A;  5IW1_C;  5IW1_E;  4P2R_D;  4P2R_I;  4P2R_N;  4P2R_S;  4MJI_D;  4MJI_I;  6ULR_D;  4NDM_B;  3TZV_A;  3TZV_G;  3QIW_C;  3AXL_A;  3AXL_G;  6UK2_D;  3SDX_E;  3SDX_G;  6RSY_D;  6RSY_I;  2WBJ_C;  2WBJ_G;  3TN0_C;  2PO6_C;  2PO6_G;  3SDA_C;  6DFS_A;  5TJE_E;  5TJE_G;  3SDC_C;  5NQK_A;  4Y4H_C;  4Y4H_G;  2J8U_E;  2J8U_L;  6MKD_A;  6V80_C;  6V80_H;  1ZGL_M;  1ZGL_Q;  1ZGL_S;  1ZGL_U;  6DFW_E;  6DFW_G;  4ELM_E;  4ELM_G;  5W1V_D;  5W1V_I;  5W1V_N;  5W1V_S;  4ONH_A;  3SDD_C;  4MNH_B;  4MNH_D;  6MKR_A;  3SJV_D;  3SJV_I;  3SJV_N;  3SJV_S;  4GG6_E;  4GG6_G;  3PQY_D;  3PQY_I;  3PQY_N;  3PQY_S;  5FK9_A;  3C60_A;  3C60_E;  1G6R_A;  1G6R_C;  6BJ2_D;  4GG8_A;  4GG8_E;  4LCC_A;  4L9L_A;  6UON_G;  6UON_I;  1YPZ_E;  1YPZ_G;  3C6L_A;  3C6L_E;  4Y1A_D;  5D7L_D;  5D7L_G;  5D2L_E;  5D2L_I;  5D2L_K;  5D2L_O;  1YMM_D;  3T0E_C;  2CDE_A;  2CDE_C;  2CDE_E;  3DXA_D;  3DXA_I;  3DXA_N;  5E6I_A;  5E6I_F;  5E6I_G;  5E6I_P;  6U3N_D;  6U3O_A;  6U3O_G;  6EH4_E;  6FR4_B;  6EH5_B;  4UDT_B;  6FR3_B;  6FR5_B;  4WW1_B;  2NW2_B;  6AT6_B;  1OGA_E;  2BNU_B;  6FUN_B;  1KGC_E;  6FRC_B;  6FUQ_B;  6FR9_B;  6FUO_B;  4EI6_B;  4EI6_D;  6BJ8_H;  6DFV_B;  6DFV_D;  6MRA_B;  6FUP_B;  5TEZ_J;  4DZB_B;  6PUG_E;  6PUG_H;  6OVN_B;  1BEC_A;  6PUD_E;  6PUD_H;  6FUR_B;  6FUR_D;  6PUL_E;  6PUL_G;  6FUM_B;  6CPH_E;  5M02_H;  6PUC_E;  6PUC_H;  6FRA_B;  6PUH_E;  6PUH_G;  6EH6_B;  6W9U_E;  6W9U_H;  2BNQ_E;  4WNQ_B;  4WNQ_D;  2Q86_B;  2Q86_D;  6FRB_B;  5D7K_E;  6PUJ_E;  6PUJ_G;  6PUM_E;  6PUM_H;  6VTC_B;  3VXS_E;  6PUI_E;  6PUI_G;  6W9V_E;  6W9V_H;  2P5E_E;  4L4V_E;  4L4V_H;  3Q5Y_A;  3Q5Y_B;  3Q5Y_C;  3Q5Y_D;  5U6Q_E;  5U6Q_G;  6EH7_B;  6PUF_E;  6PUF_H;  4PJE_F;  4PJE_H;  6G9Q_H;  6PVC_F;  6PVC_H;  6BJ3_H;  4MS8_D;  4G9F_E;  6MJJ_D;  4PJH_F;  4PJH_H;  5KSA_D;  5D7J_B;  5D7J_H;  4PJ9_D;  6PUE_E;  6PUE_H;  5U16_F;  5U16_H;  5D7I_F;  5D7I_H;  6R0E_EEE;  4PJ5_E;  4PJ5_H;  5C0C_E;  5C0C_J;  5M01_H;  6MJ4_D;  4L4T_E;  4L4T_H;  5EU6_E;  5M00_H;  6ULN_E;  2IAL_B;  2IAL_D;  6DFX_H;  6DFX_J;  6CW9_D;  2F53_E;  6PUK_E;  6PUK_G;  6TMO_E;  6MIV_D;  5ISZ_E;  3QJH_B;  3QJH_D;  5C0B_E;  5C0B_J;  5YXN_B;  3MFF_B;  3MFF_D;  6PVD_E;  6PVD_H;  2VLM_E;  2BNR_E;  5IVX_F;  5NMD_B;  5NMD_D;  4NQE_E;  4NQE_H;  6OMG_D;  6CUH_B;  6AVF_B;  4X6B_B;  4X6B_D;  4ELK_B;  4ELK_D;  2P5W_E;  4ZDH_B;  6AMU_E;  5U17_E;  5U17_G;  5D5M_F;  5D5M_H;  5C07_E;  5C07_J;  1LP9_F;  1LP9_M;  6CXE_D;  4P23_B;  3VXQ_B;  3VXQ_E;  5U2V_F;  5U2V_H;  4PJX_F;  4PJX_H;  3MV7_E;  5D2N_E;  5D2N_F;  4G8F_B;  4NQD_E;  4NQD_H;  3QEU_B;  3QEU_E;  3TJH_D;  4GRM_B;  4GRM_D;  3Q5T_A;  5WLG_E;  5WLG_J;  4MAY_D;  3QUY_D;  2CDF_B;  2XNA_B;  3QH3_B;  3QH3_D;  6CWE_D;  6V1A_E;  4PJG_F;  4PJG_H;  5EUO_F;  5EUO_H;  3MV8_E;  6MJI_D;  3RUG_F;  3RUG_H;  2PYF_B;  3QUZ_D;  6BGA_D;  4Y19_E;  2PYE_E;  2EYS_B;  4LCW_E;  4LCW_H;  4G8G_E;  4NQC_E;  4NQC_H;  4PJC_F;  4PJC_H;  6V18_E;  6CX9_D;  4JRX_E;  4PJF_F;  4PJF_H;  6CUG_E;  6MJA_D;  6VM8_E;  4PJ7_F;  4PJ7_H;  5U72_E;  5U72_G;  6OVO_B;  3REV_B;  6D78_E;  5C08_E;  5C08_J;  6R2L_E;  4PRP_E;  6MJ6_D;  2VLJ_E;  3QFJ_E;  3VXR_E;  6AM5_E;  4JFH_E;  6L9L_D;  6L9L_H;  2VLR_E;  2VLR_J;  5C0A_E;  5C0A_J;  6FR7_B;  5BS0_E;  4G8E_B;  2XN9_B;  4PJI_F;  4PJI_H;  6VTH_B;  6VTH_E;  6VRN_E;  6C61_B;  1J8H_E;  4WW2_B;  3QJF_B;  3QJF_D;  4WO4_D;  4PRI_E;  5FKA_B;  4JFD_E;  4PJA_F;  4PJA_H;  6BNL_D;  6BNL_H;  6CQN_E;  5JHD_E;  5JHD_J;  6CXF_D;  6CX5_D;  5JZI_E;  5JZI_J;  4JFF_E;  2NTS_P;  5C09_E;  5C09_J;  6FR8_B;  3W0W_E;  6CQL_E;  2YPL_E;  4P2O_D;  5KS9_F;  5KS9_H;  1TCR_B;  3QDJ_E;  5WJO_B;  5WJO_D;  4Z7U_F;  4Z7U_H;  4PJD_F;  4PJD_H;  6AVG_D;  6AVG_E;  1SBB_A;  1SBB_C;  2GJ6_E;  4Z7V_F;  4Z7V_H;  6VRM_E;  3VXM_E;  3QI9_D;  3UTT_E;  3UTT_J;  4PRH_E;  2EYR_B;  5BRZ_E;  4OZF_H;  4E41_E;  4E41_J;  4PJB_F;  4PJB_H;  6C68_B;  6C68_D;  6V19_E;  3HUJ_F;  3HUJ_H;  5U1R_E;  5U1R_G;  5HHM_E;  5HHM_J;  6CXA_D;  2VLK_E;  1L0Y_A;  1L0Y_C;  4X6C_F;  4X6C_H;  3OF6_A;  3OF6_B;  3OF6_C;  4EN3_B;  6XQQ_B;  6XQQ_D;  6CX7_D;  2EYT_B;  2EYT_D;  1MI5_E;  2UWE_F;  2UWE_M;  3KPS_E;  4MXQ_D;  4Y16_D;  6EH8_B;  3PWP_E;  3VXT_B;  3VXT_D;  6EQB_E;  6MIY_D;  6MIY_H;  3O4L_E;  6VQO_E;  6VQO_J;  6Q3S_E;  3QEQ_E;  5XOV_H;  5XOV_J;  4GKZ_B;  3O8X_D;  4E42_B;  4E42_D;  2ESV_E;  6EH9_B;  4P46_B;  4JFE_E;  5NMG_E;  5NMG_J;  4IRS_D;  3UTS_E;  3UTS_J;  1FYT_E;  6DFQ_B;  6DFQ_D;  6DFQ_F;  6DFQ_H;  6C09_D;  5MEN_E;  3TA3_D;  3KPR_E;  3KPR_J;  2CDG_B;  3RDT_B;  1BD2_E;  4L3E_E;  3PL6_D;  3O9W_D;  6V15_E;  4JRY_E;  5XOT_E;  3DX9_B;  3DX9_D;  2JCC_F;  2JCC_M;  3UTP_E;  3UTP_L;  4X6D_F;  4X6D_H;  3D39_E;  3ARB_D;  3QIU_D;  4UDU_B;  4APQ_D;  2AK4_E;  2AK4_J;  2AK4_P;  2AK4_U;  6V13_E;  6XQP_F;  6XQP_H;  3QDG_E;  4P4K_D;  4P4K_H;  5SWZ_E;  5SWZ_J;  5SWZ_O;  5SWZ_T;  5NMF_E;  5NMF_J;  6RPB_E;  6RPB_J;  6RPB_O;  6RPB_T;  5WKI_E;  4N0C_D;  4N0C_H;  3H9S_E;  6V0Y_E;  6UK4_E;  3QIB_D;  6CQQ_E;  6CQQ_J;  6MSS_B;  4MNQ_E;  4FTV_E;  3VWK_D;  2IAM_D;  3C5Z_B;  3C5Z_F;  5WKF_E;  5WKF_J;  3SKN_B;  3SKN_D;  3SKN_F;  3SKN_H;  2F54_E;  2F54_L;  4IRJ_D;  4GRL_D;  2AXJ_A;  2AXJ_B;  6MNG_B;  3QDM_E;  1QRN_E;  6CW6_D;  5NME_E;  5NME_J;  3RGV_B;  1AO7_E;  6RPA_E;  4PJ8_D;  3D3V_E;  6PY2_E;  3TYF_B;  3TYF_D;  4QRP_E;  4QRP_I;  4QRP_L;  4ZAK_D;  4Y4K_D;  3ARE_D;  3FFC_E;  3FFC_J;  3QUX_D;  4IIQ_B;  2AXH_A;  2AXH_B;  6CWB_D;  6P64_E;  6P64_J;  5WKH_E;  5WKH_J;  5YXU_B;  5YXU_G;  3MV9_E;  2IAN_E;  2IAN_J;  2IAN_O;  2IAN_T;  6MNN_B;  4N5E_D;  1MWA_B;  1MWA_D;  5TIL_H;  5TIL_L;  3HE7_D;  3TVM_D;  3TVM_H;  6FR6_B;  4OZH_F;  4OZH_H;  4OZG_F;  4OZG_H;  3RTQ_D;  4QOK_E;  6EQA_E;  6PX6_E;  1L0X_A;  1L0X_C;  3SCM_D;  6MNO_B;  5VCJ_D;  4WWK_B;  5KSB_F;  5KSB_H;  4EI5_D;  4EI5_H;  4QRR_E;  3GSN_B;  3RZC_D;  3O6F_D;  3O6F_H;  4P5T_B;  4P5T_F;  3ARF_D;  6TRO_E;  4Z7W_F;  4Z7W_H;  5SWS_E;  6MJQ_D;  6MJQ_H;  3ARD_D;  4L8S_B;  4NHU_B;  4NHU_D;  1QSE_E;  1NFD_B;  1NFD_D;  3TFK_D;  4P2Q_E;  4P2Q_J;  4P2Q_O;  4P2Q_T;  2CKB_B;  2CKB_D;  1QSF_E;  4C56_B;  4C56_H;  5HYJ_E;  5HYJ_J;  6BNK_D;  6BNK_H;  6MTM_E;  4Y2D_D;  4Y2D_H;  4EUP_H;  4EUP_J;  3HE6_D;  6DKP_E;  5W1W_E;  5W1W_J;  5W1W_O;  5W1W_T;  3KXF_E;  3KXF_H;  3KXF_O;  3KXF_P;  6CQR_E;  6CQR_J;  3TO4_D;  5HHO_E;  6VMX_E;  6VMX_J;  6MNM_B;  2NX5_E;  2NX5_J;  2NX5_P;  2NX5_U;  4OZI_F;  4OZI_H;  3VXU_E;  3VXU_J;  3ARG_D;  6RP9_E;  6RP9_J;  6RP9_L;  5NHT_B;  4Y4F_D;  4Y4F_H;  5L2K_E;  3MBE_D;  3MBE_H;  3VWJ_D;  4MVB_D;  3TPU_B;  3TPU_D;  3TPU_H;  3TPU_N;  5IW1_B;  5IW1_D;  5IW1_F;  4P2R_E;  4P2R_J;  4P2R_O;  4P2R_T;  4MJI_E;  4MJI_J;  6ULR_E;  4NDM_A;  3TZV_B;  3TZV_H;  3QIW_D;  3AXL_B;  3AXL_H;  6UK2_E;  3SDX_F;  3SDX_H;  6RSY_E;  6RSY_J;  2WBJ_D;  2WBJ_H;  3TN0_D;  2PO6_D;  2PO6_H;  3SDA_D;  6DFS_B;  5TJE_F;  5TJE_H;  3SDC_D;  5NQK_B;  4Y4H_D;  4Y4H_H;  2J8U_F;  2J8U_M;  6MKD_B;  6V80_D;  6V80_I;  1ZGL_P;  1ZGL_R;  1ZGL_T;  1ZGL_V;  6DFW_F;  6DFW_H;  4ELM_F;  4ELM_H;  5W1V_E;  5W1V_J;  5W1V_O;  5W1V_T;  4ONH_B;  3SDD_D;  4MNH_A;  4MNH_C;  6MKR_B;  3SJV_E;  3SJV_J;  3SJV_O;  3SJV_T;  4GG6_F;  4GG6_H;  3PQY_E;  3PQY_J;  3PQY_O;  3PQY_T;  5FK9_B;  3C60_B;  3C60_F;  1G6R_B;  1G6R_D;  6BJ2_E;  1JCK_A;  1JCK_C;  4GG8_B;  4GG8_F;  4LCC_B;  4L9L_B;  6UON_H;  6UON_J;  3C6L_B;  3C6L_F;  4Y1A_E;  5D7L_E;  5D7L_H;  5D2L_F;  5D2L_J;  5D2L_L;  5D2L_P;  1YMM_E;  3T0E_D;  1KTK_E;  1KTK_F;  2CDE_B;  2CDE_D;  2CDE_F;  3DXA_E;  3DXA_J;  3DXA_O;  5E6I_B;  5E6I_H;  5E6I_L;  5E6I_Q;  6U3N_E;  6U3O_B;  6U3O_H; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling