1SLVAB

Rat anionic n143h, e151h trypsin complexed to a86h ecotin; copper-bound
A: 89-93 B: 34-37,66-68,113-118,125-127,130-132,145-150,204-209,217-219
Link type Probability Chain A piercings Chain B piercings
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
view details
Unlink Unlink 61% -23B -139B +155B +246B
Interpreting sequences
Chain A Sequence
IAPYPQAEKGMKRQVIQLTPQEDESTLKVELLIGQTLEVDCNLHRLGGKLENKTLEGWGYDYYVFDKVSSPVSTMMHCPD---EKKFVTAYLGDAGMLRYNSKLPIVVYTPDNVDVKYRVWKAEEKIDNAVVR
Chain A Sequence
IVGGYTCQENSVPYQVSLN--SGYHFCGGSLINDQWVVSAAHCYKSRIQVR-LGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVK----VATVALPS-SCAP-AGTQCLISGWGHTL----NHPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCN----GELQGIVSW-GYGCALPDNPGVYTKVCNYVDWIQDTIAAN
sequence length 133,223
structure length 130,215
publication title X-ray structures of a designed binding site in trypsin show metal-dependent geometry.
pubmed doi rcsb
molecule tags Complex (serine protease/inhibitor)
molecule keywords ECOTIN
source organism Escherichia coli
missing residues A: 89-93 B: 34-37,66-68,113-118,125-127,130-132,145-150,204-209,217-219
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date1996-02-07
LinkProt deposition date2016-10-29

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF03974 EcotinEcotin
AB PF00089 TrypsinTrypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.550 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1slvA00
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slvB01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1slvB02
1SLVAB 1AQ7AB 3FP7EJ 1AKSAB 3FP7EI 3FP7EIJ
chains in the LinkProt database with same CATH superfamily
3HPJBDE 1AGBAC 3H4FABC 3E2HABQ 1ZLWHLM 3KDPABC 1OP3HKL 1SLVAB 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3JWNHLM 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3FT3AP 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3H4HBC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 3JTTDG 3JWNCGK 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FCSBC 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3JWNFIK 3HAEHL 1A9BBDF 3E3QBCG 1AHWDE 1UT1DE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 3HG1ABC 3H9SACE 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3FCSABC 3JTTAEI 1ZLUKLM 1Q8MBC 3FQNAC 3FP7EIJ 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HPJDEF 3HNVHL 3JWNIKN 3H4FBC 1OP3HM 3JTTDGH 3JWNFGN 1AGBABC 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 3FONCD 1UT1CF 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 3GEFACD 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3K5SAB 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3GEFAB 3H4HAB 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 3GIVADE 1A1MAC 3E3QeF 1UT1AD 3KDPCDG 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3JWNCFN 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1GMECD 3FOMAB 3KDPABD 3JWNHIL 2W5PAB 3FT4AP 1ZLVHL 2VSCAC 1UT1ADE 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3GEFBCD 1ZXKAB 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3JWNIKL 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3H4FAC 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3GJFDF 3H9HABC 1OP5HL 3GSNAB 3JWNHMN 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HPJACE 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IXADF 3FCSAB 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3JWNEHK 3EFFAM 3FQRABC 3JWNCEH 3DX8ABC 3HCVAB 3HAEST 3JWNCFL 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3JWNGHM 3H9SABC 3FCSAD 3JWNHLN 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 1AQ7AB 3FFCACD 3GSNHLP 1ZLSHL 3JWNHN 3DXAAKM 3GJFEH 3GEFCD 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FCSBCD 3FQNABC 3GEFABC 3H4HABC 3GJFDE 1A9BADF 3HAEDEF 3FP7EI 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3JWNCGH 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3DX7AB 3HAEPQR 3IVKAH 3JWNEHN 1AGFAC 3JWNCEM 1AKSAB 3HAEDFM 1A9BACF 3FQTAC 3FCSCD 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3KDPACD 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JWNGH 3JTTCGH 3GIZHL 3GSWABP 3GEFBD 1UT1BF 1AGCABC 1ZVNAB 3FCSABD 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3JWNGN 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3GEFABD 3JWNIK 1ZLULM 3GSRAP 3H7BDEF 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3JWNCEL 3FFCACF 3H9HACD 3DXAACK 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3GEFAD 3F7YAB 1OP3HKM 1OP3HLM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 1Q8MCD 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 1UT1BC 3E3QADQ 3JWNCEK 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3H9SACD 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3KDPABG 3JWNHIK 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3JWNIKM 3HC3HL 3JWNGHI 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3H4FAB 3JWNMN 3DXAFH 3KDPAB 3E3Qcdf 3JWNLMN 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3KDPCD 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 2W5PABC 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3FCSACD 3JWNCGL 3DX9CD 3H4HAC 2W5PBC 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1UT1AE 1AIFHL 3JWNEFH 3FCTAB 3JTTAGH 3JWNGIK 3H7BDF 3GEFBC 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3GEFAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1A9BAB 1OP5HKLM 1OP5KM 3E3QPST 3JWNHIM 3HG1ACD 3FFCAC 1GMEAB 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3JTTDEI 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3KDPBCH 1ZLUHKLM 3FRUEF 1A9BDF 3JWNCE 3FFCACE 3GSWAP 3IXAAD 3IVKBL 3JWNFHL 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3KDPCDH 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 3JWNCGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 1QEXAB 3HAEJMO 3GSOAB 3FRUAD 1OM3HK 1UT1BCF 3HAEDFK 3JTTCDF 1AGFAB 3GJEABL 3JWNCEN 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3JWNCGN 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 2W5PAC 3FCSAC 3KDPABH 3FQUABC 3JTTBDF 3FP7EJ 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3JWNCEG 3KDPBCG 3E3QDE 3DXAEJ 3JWNGMN 3JWNCFM
chains in the LinkProt database with same CATH topology
3JWNCGH 3JWNGHM 3JWNCE 3JWNFGN 3JWNHLN 3JWNMN 3JWNEFH 3JWNIKL 3JWNCEN 3JWNCGK 3JWNGIK 3JWNFHL 3JWNLMN 3JWNHIK 3JWNCFN 3JWNIKN 3JWNEHN 3JWNHLM 3JWNCGN 1AQ7AB 3JWNGN 3JWNCEM 1AKSAB 3JWNEHK 3FP7EIJ 3JWNHIL 1SLVAB 3JWNCEH 3JWNHN 3JWNFIK 3JWNIK 3JWNCEL 3JWNCEG 3JWNGMN 3JWNHIM 3JWNCFL 3FP7EJ 3JWNCGI 1GMEAB 1GMECD 3JWNHMN 3JWNCEK 3JWNCGL 3JWNGH 3JWNIKM 3JWNCFM 3FP7EI 3JWNGHI
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 1SLV AB;  1AQ7 AB;  3FP7 EJ;  1AKS AB;  3FP7 EI;  3FP7 EIJ; 
#chains in the LinkProt database with same CATH topology
 3HPJ BDE;  1AGB AC;  3H4F ABC;  3E2H ABQ;  1ZLW HLM;  3KDP ABC;  1OP3 HKL;  1SLV AB;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3JWN HLM;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3FT3 AP;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3H4H BC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  3JTT DG;  3JWN CGK;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FCS BC;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3JWN FIK;  3HAE HL;  1A9B BDF;  3E3Q BCG;  1AHW DE;  1UT1 DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  3HG1 ABC;  3H9S ACE;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3FCS ABC;  3JTT AEI;  1ZLU KLM;  1Q8M BC;  3FQN AC;  3FP7 EIJ;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HPJ DEF;  3HNV HL;  3JWN IKN;  3H4F BC;  1OP3 HM;  3JTT DGH;  3JWN FGN;  1AGB ABC;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  3FON CD;  1UT1 CF;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  3GEF ACD;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3K5S AB;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3GEF AB;  3H4H AB;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  3GIV ADE;  1A1M AC;  3E3Q eF;  1UT1 AD;  3KDP CDG;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3JWN CFN;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1GME CD;  3FOM AB;  3KDP ABD;  3JWN HIL;  2W5P AB;  3FT4 AP;  1ZLV HL;  2VSC AC;  1UT1 ADE;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3GEF BCD;  1ZXK AB;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3JWN IKL;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3H4F AC;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3GJF DF;  3H9H ABC;  1OP5 HL;  3GSN AB;  3JWN HMN;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HPJ ACE;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IXA DF;  3FCS AB;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3JWN EHK;  3EFF AM;  3FQR ABC;  3JWN CEH;  3DX8 ABC;  3HCV AB;  3HAE ST;  3JWN CFL;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3JWN GHM;  3H9S ABC;  3FCS AD;  3JWN HLN;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  1AQ7 AB;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3JWN HN;  3DXA AKM;  3GJF EH;  3GEF CD;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FCS BCD;  3FQN ABC;  3GEF ABC;  3H4H ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3FP7 EI;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3JWN CGH;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3DX7 AB;  3HAE PQR;  3IVK AH;  3JWN EHN;  1AGF AC;  3JWN CEM;  1AKS AB;  3HAE DFM;  1A9B ACF;  3FQT AC;  3FCS CD;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3KDP ACD;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JWN GH;  3JTT CGH;  3GIZ HL;  3GSW ABP;  3GEF BD;  1UT1 BF;  1AGC ABC;  1ZVN AB;  3FCS ABD;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3JWN GN;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3GEF ABD;  3JWN IK;  1ZLU LM;  3GSR AP;  3H7B DEF;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3JWN CEL;  3FFC ACF;  3H9H ACD;  3DXA ACK;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3GEF AD;  3F7Y AB;  1OP3 HKM;  1OP3 HLM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  1Q8M CD;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  1UT1 BC;  3E3Q ADQ;  3JWN CEK;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3H9S ACD;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3KDP ABG;  3JWN HIK;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3JWN IKM;  3HC3 HL;  3JWN GHI;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3H4F AB;  3JWN MN;  3DXA FH;  3KDP AB;  3E3Q cdf;  3JWN LMN;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3KDP CD;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  2W5P ABC;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3FCS ACD;  3JWN CGL;  3DX9 CD;  3H4H AC;  2W5P BC;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1UT1 AE;  1AIF HL;  3JWN EFH;  3FCT AB;  3JTT AGH;  3JWN GIK;  3H7B DF;  3GEF BC;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3GEF AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1A9B AB;  1OP5 HKLM;  1OP5 KM;  3E3Q PST;  3JWN HIM;  3HG1 ACD;  3FFC AC;  1GME AB;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3JTT DEI;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3KDP BCH;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3JWN CE;  3FFC ACE;  3GSW AP;  3IXA AD;  3IVK BL;  3JWN FHL;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3KDP CDH;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  3JWN CGI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  1QEX AB;  3HAE JMO;  3GSO AB;  3FRU AD;  1OM3 HK;  1UT1 BCF;  3HAE DFK;  3JTT CDF;  1AGF AB;  3GJE ABL;  3JWN CEN;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3JWN CGN;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  2W5P AC;  3FCS AC;  3KDP ABH;  3FQU ABC;  3JTT BDF;  3FP7 EJ;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3JWN CEG;  3KDP BCG;  3E3Q DE;  3DXA EJ;  3JWN GMN;  3JWN CFM; 
#chains in the LinkProt database with same CATH homology
 3JWN CGH;  3JWN GHM;  3JWN CE;  3JWN FGN;  3JWN HLN;  3JWN MN;  3JWN EFH;  3JWN IKL;  3JWN CEN;  3JWN CGK;  3JWN GIK;  3JWN FHL;  3JWN LMN;  3JWN HIK;  3JWN CFN;  3JWN IKN;  3JWN EHN;  3JWN HLM;  3JWN CGN;  1AQ7 AB;  3JWN GN;  3JWN CEM;  1AKS AB;  3JWN EHK;  3FP7 EIJ;  3JWN HIL;  1SLV AB;  3JWN CEH;  3JWN HN;  3JWN FIK;  3JWN IK;  3JWN CEL;  3JWN CEG;  3JWN GMN;  3JWN HIM;  3JWN CFL;  3FP7 EJ;  3JWN CGI;  1GME AB;  1GME CD;  3JWN HMN;  3JWN CEK;  3JWN CGL;  3JWN GH;  3JWN IKM;  3JWN CFM;  3FP7 EI;  3JWN GHI; 
1ACBE
similar chains in the LinkProt database (40% sequence similarity)
1SLUA 1SLWA 1N8OE 1SLXA 1IFGA 1EZSA 1EZSB 1AZZC 1AZZD 1ECYA 1XX9C 1XX9D 1EZUA 1EZUB 1ID5I 1ECZA 1ECZB 1XXFC 1XXFD 4NIYE 4NIYF 4NIYG 4NIYH 1P0SE 2Y6TE 2Y6TF 2Y6TG 2Y6TH 1XXDC 1XXDD 4IW4C 4IW4D 4I8HA 5MN1A 5MNKA 3MI4A 3MFJA 4I8GA 4I8KA 5MNNA 5MNGA 4I8LA 4I8JA 4XOJA 5MNCA 5MNHA 5MNBA 5MONA 2XTTB 5MNOA 1HJ9A 6SY3A 5MORA 5MNMA 5MOPA 5MNFA 4U2WA 5MNPA 2AYWA 5MNEA 1HJ8A 2QXIA 5MNLA 1S0RA 1S0QA 4K8YA 4NIVA 7BS6A 7BS4A 7BS7A 7BS9A 6T9UA 2AH4X 5F6MA 3NKKA 2AGIX 1UTNA 6T5WA 2AGEX 3NK8A 6T9VA 6SV8A 6SV6A 6O21A 2UUYA 6SUXA 6SV0A 4KELA 6SW0A 6SVZA 6SVBA 1UTQA 6SV9A 6SVNA 6SVRA 6SVWA 6SVXA 1UTOA 6SVDA 3UNRA 4YTAA 2BLVA 6EATA 2BLWA 6SVVA 6SVUA 6SVGA 5FAHA 3PLBA 5LGOA 6T0PA 6SVJA 6SVIA 1Y59T 3NCLA 6EAUA 6EAXA 4AB9A 3P8GA 2XW9A 7BS5A 4MTBA 5TP0A 7BSAA 5NAWA 5UGGA 6TS4A 1J8AA 2BY5X 2BY9X 2BY6X 2BY7X 4KTSA 4Y0YE 2BY8X 2BYAX 2A31A 3P95A 4ABBA 4ABAA 2AGGX 4ABHA 4ABDA 4HGCA 5FCRA 5FCRB 5FCRC 5FCRD 6BFPA 4NIXA 1S83A 4Y11E 4NIWA 6EAWA 4K1EA 1UTPA 6USYA 4TPYA 4ABFA 4CRGA 5MT0A 4ABEA 3GYLB 6MRQA 5MNQA 5NB7A 6QIHA 6DWRA 7BRZA 7BS3A 4KTUA 2OXSA 2ZQ2A 4Y0ZE 5PTPA 6FUHA 4Y10E 6FUIA 6TS5A 1EAXA 4NCYA 7BRXA 1P2JA 5LH4A 5EG4A 1N6XA 4AG1A 6EAVA 1N6YA 1S5SA 7BS8A 6D3YA 5UGDA 6TS6A 1C1QA 1C1TA 1O3DA 1C5TA 6T7PA 1C1PA 4B2BA 4B2BC 5MNAA 1Y5AT 5JBTA 1C5UA 4DG4A 4DG4B 4DG4D 4DG4G 3A8AA 6U22A 5TJXA 2R9PA 2R9PB 2R9PC 2R9PD 3UWIA 1GHZA 1O35A 4B2CA 4B2CC 1GI2A 1C5SA 1GI1A 1GI4A 1S6HA 1GVZA 1O38A 1C1RA 2RA3A 2RA3B 5FBEA 5MOOA 1C1NA 1C2HA 1O3JA 1C2JA 2ZFSA 2ANYA 1TPPA 1GI0A 3PLKA 4Q7ZA 1O2WA 1C2MA 1O3KA 2G8TA 4IS5A 1C1OA 5MOQA 6SWVAAA 6T0MA 3PMJA 6D40A 1O2UA 2J9NA 5T3HA 3P92A 3FP7E 3FP8E 2A32A 6FUTA 1O3LA 5FBIA 1BTYA 1O33A 1C2IA 1C5PA 1C5QA 6VXYA 3PM3A 5EXNA 5MOSA 1TLDA 4ABJA 3DFJA 6HARA 3LJOA 7BS1A 2PLXA 5LH8A 4ABGA 2G81E 2G5VA 1O2RA 7BRVA 3GY4A 1O2QA 1GI3A 1C5RA 1O2PA 5NARA 5F8ZA 5TKSA 4K60A 3FP6E 2BTCE 1O2YA 1O34A 1GI6A 1BIOA 3PWCA 1C5VA 1UTMA 1GJ6A 3ITIA 3NPSA 3GY2A 1UTKA 2G5NA 1O2IA 1XUIA 4WVPE 1O3NA 1O3HA 4AFQA 4AFQB 3GY5A 1O3IA 2OTVA 1O2NA 1C2LA 1O3MA 3GY7A 4K69A 1O2XA 1Y5UT 3V13A 3FVFB 5ABWA 2ZDKA 1Y3VA 1O30A 1O37A 1O3GA 6E5MA 1XUGA 3RXIA 2ZPSA 3UPEA 1MCTA 3RXOA 6NVBA 6NVBB 6NVBC 6NVBD 1O3FA 3RXPA 1O2VA 3RXKA 1DPOA 4AB8A 3PWBA 4ABIA 1O3OA 6QL0A 2PTNA 7BRWA 6VTMA 6VTMC 6VTMD 6VTMG 1BTXA 1C2GA 3BG8A 1Y5BT 1F7ZA 7BRYA 1O39A 1LO6A 1FNIA 3UNQA 3PLPA 4CRCA 1O3EA 3E16B 3RXUA 3RXQA 1Y3XA 3RU4T 1V2LT 1J16A 1O2TA 1V2OT 2FX6A 3RXBA 1H9HE 2ZQ1A 4D7FA 1O2KA 2O9QA 1SFIA 3T26A 3T25A 3E0NB 3M7QA 1O3CA 2FI3E 1C1SA 3A7WA 3RXMA 1O2JA 1C2EA 3OTJE 3RXDA 6FTYA 3ATMA 3RXAA 3RXGA 1XUKA 3RXVA 3RXFA 3RXEA 1P2KA 1GI5A 3RXLA 3A7VA 3RXHA 4U32A 1BTWA 6FTZA 3T29A 1O2OA 5F8XA 2FI5E 3RXJA 3RXRA 3A7TA 6QFFA 6QFFB 6VLUA 3RXCA 1O2SA 1QQUA 6QFHA 6QFHB 3A82A 1TX8A 3A86A 1F5RA 3A84A 3E1XB 3A8DA 6O1SE 1SPJA 3A83A 5MT4A 2FX4A 3A81A 4WWYA 4WWYB 1A0JA 1A0JB 1A0JC 1A0JD 3A87A 1O31A 2FI4E 3A85A 3ATLA 3Q00A 3A88A 3A7XA 3A8BA 1O2ZA 1C2DA 2ZDLA 1S81A 1UTLM 3RXSA 3RXTA 1JRTA 3A7YA 3ATKA 2OQ5A 3GY3A 3A89A 3GY6A 3E0PB 1Y3YA 2ZFTA 1TPOA 6VLVA 4CR9A 7BS2A 4AORA 4AORB 4AORC 3A80A 3PTBA 3UOPA 3AAVA 3AAVB 1FY8E 1P2IA 3A7ZA 3TGKE 1C2KA 4CREA 1Y3UA 6T9TA 2FTLE 6QFGA 6QFGB 1O2LA 6AHSA 1O3BA 1TGTA 1S6FA 1QBNA 1H4WA 3GY8A 5YJPA 3AASA 2FTMA 1C2FA 1YLDA 1O36A 4D8NA 3D65E 1ZHRA 1O2MA 1FN6A 1T8OA 1T8OC 1RXPA 4GUXA 4GUXB 4GUXC 1V2MT 5XWJA 5XWJB 3LJJA 1SBWA 1YLCA 3ATIA 1T8LA 1T8LC 2G55A 5A0AE 3PTNA 4CBOA 4CBOB 1PPFE 1YKTA 1V2RT 1TX7A 1TNHA 3A8CA 1MBQA 6QFEA 6QFEB 1G3DA 1TNJA 6BVHA 1S84A 1P57B 1H9IE 1BJUA 1TNKA 1UTJA 1V2ST 2Z7FE 1G3CA 1QA0A 1TNGA 3AAUA 1V2NT 1G3BA 2CGAA 2CGAB 1AVWA 4D76A 1QCPA 1JRSA 1QB9A 2STBE 1HNEE 2TGTA 5FXLA 1Y3WA 3TGIE 6B6TA 6B6QA 1F2SE 6B6RA 1MAYA 6B6NA 5YJMA 4B1TA 4B1TC 1XUJA 1F0TA 3UNSA 6B6SA 6B6PA 4AG2A 4AG2B 1G3EA 1PPCE 5QTYA 1DICA 1XUFA 1QB1A 4NZLA 6AODC 1V6DA 1TAWA 1T8NA 1T8NC 1O5EH 3N7OA 1O32A 1GVLA 4TY6A 1O2HA 4CRAA 1TGSZ 1ZZZA 4Y8XA 1QBOA 1T32A 1V2WT 1FMGA 5ZFIA 1QB6A 1AZ8A 3BTHE 5A09A 1NN6A 1BTZA 1V2UT 1K2I1 1CGHA 2ZPRA 2ZPRB 1P2MA 1P2MC 6D3XA 6D3XB 1CE5A 1TNIA 3V12A 5JYIA 1O5FH 6SHIA 6SHIB 6SHIC 6SHID 6SHIE 6SHIF 6SHIG 6SHIH 1S82A 1TPSA 4CBNA 4CBNB 2ZDMA 3T27A 5A8YA 2STAE 1SLUB 1TNLA 7BS0A 3BTFE 3V0XA 4AFUA 4AFUB 1BJVA 1TONA 1PPHE 2TGAA 6QHBA 6QHBB 5NBAA 6W50A 3Q76A 3Q76B 1MTVA 1MTWA 4DGJA 4DGJB 4DGJC 4DGJD 1P2NA 1P2NC 3BTME 1K1PA 2RG3A 1T8MA 1T8MC 1Z7KA 1F0UA 3UQOA 5NX1A 2ZDNA 4X6PA 4X6PB 4O9VA 1G36A 6QMTA 6QMTB 1NC6A 2BZAA 1TPAE 1OYQA 1P2QA 1P2QC 4CRBA 1PPEE 5FCKA 4NFEA 1BITA 6AVLA 1MTSA 1MTUA 6N4TA 1T7CA 1T7CC 1MAXA 3BTEE 2BDGA 2BDGB 1KLTA 1L2EA 3PYHA 5F8TA 1AU8A 1ZHMA 3Q77A 2ZHDA 1GCDA 2PTCE 2TIOA 3BTKE 1ZSJA 5QQOA 1OX1A 1GBTA 4AFSA 3VFEA 5NB6A 3RP2A 3RP2B 1K1OA 6QHAA 6QHAB 6QHCA 6QHCB 1V2VT 2ZPQA 2ZPQB 3TPIZ 3SORA 1TIOA 6SJUA 6SJUB 6SJUC 6SJUD 6SJUE 6SJUF 6SJUG 6SJUH 2EEKA 3BTQE 1K1NA 6D3ZA 3BTDE 3BTTE 1TYNA 4AOQA 4AOQB 4AOQC 4K5ZA 3VPKA 1LDTT 5ZFHA 1EJMA 1EJMC 1EJME 5QTXA 1ZSKA 1T31A 3UUZA 3UUZB 3BTGE 4NFFA 1J15A 2TGPZ 4B2AA 4B2AC 1ZR0A 1ZR0C 3DFLA 5C67A 5C67B 1AN1E 1EB2A 1SLWB 3S0NA 1YF4A 2QXHA 1XUHA 2ANWA 1YYY1 6DWFA 6DWFB 6DWFC 6DWFD 6DWFE 6DWFF 4ISOA 1CO7E 1JIRA 5QQPA 1J17T 1V2TT 3SO3A 2FDAA 1DSUA 1DSUB 6BX8A 6BX8C 6BX8E 6BX8G 5A0CA 5A0CB 4DOQA 4DOQC 4DOQE 4JZ1A 1V2JT 1AVXA 2A7HA 6SHHA 6SHHB 6SHHC 6SHHD 6SHHE 6SHHF 6SHHG 6SHHH 6DWHA 6DWHB 6DWHC 6DWHD 6DWHE 6DWHF 3T62A 3T62B 3T62C 1V2KT 5XWLA 5XWLB 1V2PT 5A8ZA 1AUJA 1O3AA 1DDJA 1DDJB 1DDJC 1DDJD 3P8FA 5TKUA 3W94A 3W94B 5TKTA 4R0IA 1YP9A 4J2YB 4X6NA 1ANCA 1ZMJA 5Q0DA 4TY7A 1BRAA 2ZGCA 5Q0EA 3BTWE 4CR5A 5E2OA 2GV6A 2TGDA 3QK1A 1K1MA 4OGYA 4OGYB 1AQ7A 4X6OA 1NPMA 1NPMB 1PPGE 1K1IA 1LQEA 1ZTJA 1GL1A 1GL1B 1GL1C 1DSTA 1K1JA 1ZPBA 1SMFE 5Q0FA 1FXYA 4TPIZ 4CRDA 5EXMA 1D6RA 5J4SA 4JYTA 1ZMNA 1SLXB 4JZIA 5QTVA 1ANEA 1BTPA 6QMRA 6QMRB 6QMRC 6QMRD 6QMRE 6QMRF 1BRBE 6FIDA 2D8WA 1TRNA 1TRNB 1K9OE 1FIWA 1QL7A 2TPIZ 1TRMA 1TRMB 1ANDA 5A0BA 1P2OA 1P2OC 5QCLA 5A8XA 1FDPA 1FDPB 1FDPC 1FDPD 1PJPA 1BZXE 6R8XA 6SKCA 6SKCB 1DFPA 1DFPB 2ILNA 2ILNB 1QRZA 1QRZB 1QRZC 1QRZD 4O97A 4AFZA 4AFZB 5QTTA 2QXJA 1G9IE 1DLKB 1DLKD 1IAUA 1HFDA 3RDZA 3RDZB 5NX3A 2GV7A 3TGJE 4WXVA 4WXVB 1OXGA 5Y9LA 4K2YA 4CRFA 5QTWA 4ISLA 1ZSLA 1V2QT 2CMYA 3UQVA 4D9QA 4D9QB 2ZGHA 1EZSC 1EZSD 4AN7A 1H1BA 1H1BB 1QL9A 5E2PA 4Q2KA 4Q2KB 4Q2KC 4Q2KD 1OPHB 1ZRKA 1S85A 1ZMLA 1RJXB 5QCNA 1CGIE 1CGJE 5EXLA 1EUFA 5QCMA 3L3TA 3L3TB 3L3TC 3L3TD 1ZOMA 5MS4A 5MS4B 5MS4C 5MS4D 1TABE 3BN9A 3BN9B 6E69A 6E69B 6E69C 6E69D 3M35A 6QH9A 6QH9B 1K1LA 1FI8A 1FI8B 1BRCE 1TX6A 1TX6B 1TX6C 1TX6D 2F3CE 6ZOVA 6ZOVB 6ZOVC 6ZOVD 6FUGA 6FUGB 6FUGC 6FUGD 6FUGE 6FUGF 5Q0HA 1L4DA 4OGXA 6C0SA 6Y4SA 6Y4SB 6Y4SC 3VEQB 6FUJA 6FUJB 6FUJC 6FUJD 6FUJE 6FUJF 1ORFA 2PSYA 5WB6A 1J14A 4X6MA 1TFXA 1TFXB 5J4QA 3MYWA 3MYWB 1XX9A 1XX9B 5QTUA 1AMHA 1AMHB 6SKDA 6SKDB 4Y8ZA 2RDLA 2RDLB 2PSXA 2TLDE 5MS3A 4U30A 4U30B 4U30C 4U30D 1ZLRA 5YJKA 4KGAA 4KGAB 1MZAA 3E8LA 3E8LB 3L33A 3L33B 3L33C 3L33D 4NA8A 4WXIA 4D7GA 3TK9A 1EKBB 2TRMA 1EZUC 1EZUD 4D9RA 4D9RB 3I29A 5Q0GA 6KD5B 4ISNA 4Q7XA 4Q7XB 2ZGJA 6Q1UA 6Q1UB 5QCKA 1ANBA 6F5MA 6F5MB 1AO5A 1AO5B 3G01A 3G01B 6TS7A 6GFIA 6GFIB 1ZTKA 3SOSA 4Y8YA 5LYOA 5LYOB 5LYOC 3FZZA 3FZZB 3TJVA 1ZPCA 1OP8A 1OP8B 1OP8C 1OP8D 1OP8E 1OP8F 1EZXC 1EJAA 1ZPZA 4Q7YA 2QYIA 2QYIC 1ZTLA 1BUIA 1BUIB 1B0FA 3T28A 6B6OA 6SMAA 6SMAB 6SMAC 1ZJDA 1C9PA 1ZHPA 5GVTA 5GVTB 6TWBA 6TWBH 1XXFA 1XXFB 1GL0E 4NIYA 4NIYB 4NIYC 4NIYD 5LPEA 5LPEB 3UIRA 3UIRB 2ZCHP 2ZKSA 6DZFA 6A8OA 6A8OB 1BMLA 1BMLB 5LPFA 5LPFB 1QL8A 1EAWA 1EAWC 3BSQA 3BSQB 3BSQC 2HVXA 6HHCA 3TJUA 4Q80A 4Q80B 1L4ZA 5GIBA 5GIBB 6TWCA 1FIZA 3GYMA 3GYMB 1EX3A 1MZDA 2QXGA 2QXGB 2Y6TA 2Y6TB 2Y6TC 2Y6TD 2XWAA 2XWAB 4NA7A 4KP0A 1XXDA 1XXDB 3QUMP 3QUMQ 2ZCLP 3UY9A 3UY9B 3UY9C 3UY9D 3UY9E 3UY9F 3UY9G 3UY9H 3UY9I 3UY9J 3UY9K 3UY9L 3UY9M 3UY9N 3UY9O 3UY9P 2BDHA 2BDHB 2BDHC 2BDHD 2ZCKP 1FQ3A 1FQ3B 1C9TA 1C9TB 1C9TC 1C9TD 1C9TE 1C9TF 2XWBI 2XWBJ 5TCAA 5TCAB 5TCAC 5TCAD 5TCAE 5TCAF 5TCAG 5GXPA 5GXPB 2QN5T 2BDIA 2BDIB 2BDIC 2BDID 2BDIE 2BDIF 2BDIG 2BDIH 2BDII 2BDIJ 2BDIK 2BDIL 2BDIM 2BDIN 2BDIO 2BDIP 1SGFA 1SGFX 1SGFG 1SGFZ 4GAWA 4GAWB 4GAWC 4GAWD 4GAWE 4GAWF 4GAWG 4GAWH 4GAWI 4GAWJ 4GAWK 4GAWL 5TCCA 5TCCB 5TCCC 5TCCD 5TCCE 5TCCF 5TCCG 1KYNA 1KYNB 6DWUAA 6DWUAC 6DWUAE 6DWUAG 6DWUAI 6DWUAK 6DWUAM 6DWUAO 6DWUAQ 6DWUAS 6DWUAU 6DWUBA 6DWUBC 6DWUBE 6DWUBG 6DWUBI 6DWUBK 6DWUBM 6DWUBO 6DWUBQ 6DWUBS 6DWUBU 6DWUCA 6DWUCC 6DWUCE 6DWUCG 6DWUCI 6DWUCK 6DWUCM 6DWUCO 6DWUCQ 6DWUCS 6DWUCU 6DWUDA 6DWUDC 6DWUDE 6DWUDG 6DWUDI 6DWUDK 6DWUDM 6DWUDO 6DWUDQ 6DWUDS 6DWUDU 1CHGA 5NATA 5MNXA 5MNYA 5MNZA 5MO0A 5MO1A 5MO2A 5K7RA 1FUJA 1FUJB 1FUJC 1FUJD 2TBSA 1NTPA 1TGCA 1TGNA 1TGBA
similar chains in the pdb database (40% sequence similarity)

 
            
               
#similar chains in the LinkProt database (40% sequence similarity)
 1ACB_E; 
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1SLU_A;  1SLW_A;  1N8O_E;  1SLX_A;  1IFG_A;  1EZS_A;  1EZS_B;  1AZZ_C;  1AZZ_D;  1ECY_A;  1XX9_C;  1XX9_D;  1EZU_A;  1EZU_B;  1ID5_I;  1ECZ_A;  1ECZ_B;  1XXF_C;  1XXF_D;  4NIY_E;  4NIY_F;  4NIY_G;  4NIY_H;  1P0S_E;  2Y6T_E;  2Y6T_F;  2Y6T_G;  2Y6T_H;  1XXD_C;  1XXD_D;  4IW4_C;  4IW4_D;  4I8H_A;  5MN1_A;  5MNK_A;  3MI4_A;  3MFJ_A;  4I8G_A;  4I8K_A;  5MNN_A;  5MNG_A;  4I8L_A;  4I8J_A;  4XOJ_A;  5MNC_A;  5MNH_A;  5MNB_A;  5MON_A;  2XTT_B;  5MNO_A;  1HJ9_A;  6SY3_A;  5MOR_A;  5MNM_A;  5MOP_A;  5MNF_A;  4U2W_A;  5MNP_A;  2AYW_A;  5MNE_A;  1HJ8_A;  2QXI_A;  5MNL_A;  1S0R_A;  1S0Q_A;  4K8Y_A;  4NIV_A;  7BS6_A;  7BS4_A;  7BS7_A;  7BS9_A;  6T9U_A;  2AH4_X;  5F6M_A;  3NKK_A;  2AGI_X;  1UTN_A;  6T5W_A;  2AGE_X;  3NK8_A;  6T9V_A;  6SV8_A;  6SV6_A;  6O21_A;  2UUY_A;  6SUX_A;  6SV0_A;  4KEL_A;  6SW0_A;  6SVZ_A;  6SVB_A;  1UTQ_A;  6SV9_A;  6SVN_A;  6SVR_A;  6SVW_A;  6SVX_A;  1UTO_A;  6SVD_A;  3UNR_A;  4YTA_A;  2BLV_A;  6EAT_A;  2BLW_A;  6SVV_A;  6SVU_A;  6SVG_A;  5FAH_A;  3PLB_A;  5LGO_A;  6T0P_A;  6SVJ_A;  6SVI_A;  1Y59_T;  3NCL_A;  6EAU_A;  6EAX_A;  4AB9_A;  3P8G_A;  2XW9_A;  7BS5_A;  4MTB_A;  5TP0_A;  7BSA_A;  5NAW_A;  5UGG_A;  6TS4_A;  1J8A_A;  2BY5_X;  2BY9_X;  2BY6_X;  2BY7_X;  4KTS_A;  4Y0Y_E;  2BY8_X;  2BYA_X;  2A31_A;  3P95_A;  4ABB_A;  4ABA_A;  2AGG_X;  4ABH_A;  4ABD_A;  4HGC_A;  5FCR_A;  5FCR_B;  5FCR_C;  5FCR_D;  6BFP_A;  4NIX_A;  1S83_A;  4Y11_E;  4NIW_A;  6EAW_A;  4K1E_A;  1UTP_A;  6USY_A;  4TPY_A;  4ABF_A;  4CRG_A;  5MT0_A;  4ABE_A;  3GYL_B;  6MRQ_A;  5MNQ_A;  5NB7_A;  6QIH_A;  6DWR_A;  7BRZ_A;  7BS3_A;  4KTU_A;  2OXS_A;  2ZQ2_A;  4Y0Z_E;  5PTP_A;  6FUH_A;  4Y10_E;  6FUI_A;  6TS5_A;  1EAX_A;  4NCY_A;  7BRX_A;  1P2J_A;  5LH4_A;  5EG4_A;  1N6X_A;  4AG1_A;  6EAV_A;  1N6Y_A;  1S5S_A;  7BS8_A;  6D3Y_A;  5UGD_A;  6TS6_A;  1C1Q_A;  1C1T_A;  1O3D_A;  1C5T_A;  6T7P_A;  1C1P_A;  4B2B_A;  4B2B_C;  5MNA_A;  1Y5A_T;  5JBT_A;  1C5U_A;  4DG4_A;  4DG4_B;  4DG4_D;  4DG4_G;  3A8A_A;  6U22_A;  5TJX_A;  2R9P_A;  2R9P_B;  2R9P_C;  2R9P_D;  3UWI_A;  1GHZ_A;  1O35_A;  4B2C_A;  4B2C_C;  1GI2_A;  1C5S_A;  1GI1_A;  1GI4_A;  1S6H_A;  1GVZ_A;  1O38_A;  1C1R_A;  2RA3_A;  2RA3_B;  5FBE_A;  5MOO_A;  1C1N_A;  1C2H_A;  1O3J_A;  1C2J_A;  2ZFS_A;  2ANY_A;  1TPP_A;  1GI0_A;  3PLK_A;  4Q7Z_A;  1O2W_A;  1C2M_A;  1O3K_A;  2G8T_A;  4IS5_A;  1C1O_A;  5MOQ_A;  6SWV_AAA;  6T0M_A;  3PMJ_A;  6D40_A;  1O2U_A;  2J9N_A;  5T3H_A;  3P92_A;  3FP7_E;  3FP8_E;  2A32_A;  6FUT_A;  1O3L_A;  5FBI_A;  1BTY_A;  1O33_A;  1C2I_A;  1C5P_A;  1C5Q_A;  6VXY_A;  3PM3_A;  5EXN_A;  5MOS_A;  1TLD_A;  4ABJ_A;  3DFJ_A;  6HAR_A;  3LJO_A;  7BS1_A;  2PLX_A;  5LH8_A;  4ABG_A;  2G81_E;  2G5V_A;  1O2R_A;  7BRV_A;  3GY4_A;  1O2Q_A;  1GI3_A;  1C5R_A;  1O2P_A;  5NAR_A;  5F8Z_A;  5TKS_A;  4K60_A;  3FP6_E;  2BTC_E;  1O2Y_A;  1O34_A;  1GI6_A;  1BIO_A;  3PWC_A;  1C5V_A;  1UTM_A;  1GJ6_A;  3ITI_A;  3NPS_A;  3GY2_A;  1UTK_A;  2G5N_A;  1O2I_A;  1XUI_A;  4WVP_E;  1O3N_A;  1O3H_A;  4AFQ_A;  4AFQ_B;  3GY5_A;  1O3I_A;  2OTV_A;  1O2N_A;  1C2L_A;  1O3M_A;  3GY7_A;  4K69_A;  1O2X_A;  1Y5U_T;  3V13_A;  3FVF_B;  5ABW_A;  2ZDK_A;  1Y3V_A;  1O30_A;  1O37_A;  1O3G_A;  6E5M_A;  1XUG_A;  3RXI_A;  2ZPS_A;  3UPE_A;  1MCT_A;  3RXO_A;  6NVB_A;  6NVB_B;  6NVB_C;  6NVB_D;  1O3F_A;  3RXP_A;  1O2V_A;  3RXK_A;  1DPO_A;  4AB8_A;  3PWB_A;  4ABI_A;  1O3O_A;  6QL0_A;  2PTN_A;  7BRW_A;  6VTM_A;  6VTM_C;  6VTM_D;  6VTM_G;  1BTX_A;  1C2G_A;  3BG8_A;  1Y5B_T;  1F7Z_A;  7BRY_A;  1O39_A;  1LO6_A;  1FNI_A;  3UNQ_A;  3PLP_A;  4CRC_A;  1O3E_A;  3E16_B;  3RXU_A;  3RXQ_A;  1Y3X_A;  3RU4_T;  1V2L_T;  1J16_A;  1O2T_A;  1V2O_T;  2FX6_A;  3RXB_A;  1H9H_E;  2ZQ1_A;  4D7F_A;  1O2K_A;  2O9Q_A;  1SFI_A;  3T26_A;  3T25_A;  3E0N_B;  3M7Q_A;  1O3C_A;  2FI3_E;  1C1S_A;  3A7W_A;  3RXM_A;  1O2J_A;  1C2E_A;  3OTJ_E;  3RXD_A;  6FTY_A;  3ATM_A;  3RXA_A;  3RXG_A;  1XUK_A;  3RXV_A;  3RXF_A;  3RXE_A;  1P2K_A;  1GI5_A;  3RXL_A;  3A7V_A;  3RXH_A;  4U32_A;  1BTW_A;  6FTZ_A;  3T29_A;  1O2O_A;  5F8X_A;  2FI5_E;  3RXJ_A;  3RXR_A;  3A7T_A;  6QFF_A;  6QFF_B;  6VLU_A;  3RXC_A;  1O2S_A;  1QQU_A;  6QFH_A;  6QFH_B;  3A82_A;  1TX8_A;  3A86_A;  1F5R_A;  3A84_A;  3E1X_B;  3A8D_A;  6O1S_E;  1SPJ_A;  3A83_A;  5MT4_A;  2FX4_A;  3A81_A;  4WWY_A;  4WWY_B;  1A0J_A;  1A0J_B;  1A0J_C;  1A0J_D;  3A87_A;  1O31_A;  2FI4_E;  3A85_A;  3ATL_A;  3Q00_A;  3A88_A;  3A7X_A;  3A8B_A;  1O2Z_A;  1C2D_A;  2ZDL_A;  1S81_A;  1UTL_M;  3RXS_A;  3RXT_A;  1JRT_A;  3A7Y_A;  3ATK_A;  2OQ5_A;  3GY3_A;  3A89_A;  3GY6_A;  3E0P_B;  1Y3Y_A;  2ZFT_A;  1TPO_A;  6VLV_A;  4CR9_A;  7BS2_A;  4AOR_A;  4AOR_B;  4AOR_C;  3A80_A;  3PTB_A;  3UOP_A;  3AAV_A;  3AAV_B;  1FY8_E;  1P2I_A;  3A7Z_A;  3TGK_E;  1C2K_A;  4CRE_A;  1Y3U_A;  6T9T_A;  2FTL_E;  6QFG_A;  6QFG_B;  1O2L_A;  6AHS_A;  1O3B_A;  1TGT_A;  1S6F_A;  1QBN_A;  1H4W_A;  3GY8_A;  5YJP_A;  3AAS_A;  2FTM_A;  1C2F_A;  1YLD_A;  1O36_A;  4D8N_A;  3D65_E;  1ZHR_A;  1O2M_A;  1FN6_A;  1T8O_A;  1T8O_C;  1RXP_A;  4GUX_A;  4GUX_B;  4GUX_C;  1V2M_T;  5XWJ_A;  5XWJ_B;  3LJJ_A;  1SBW_A;  1YLC_A;  3ATI_A;  1T8L_A;  1T8L_C;  2G55_A;  5A0A_E;  3PTN_A;  4CBO_A;  4CBO_B;  1PPF_E;  1YKT_A;  1V2R_T;  1TX7_A;  1TNH_A;  3A8C_A;  1MBQ_A;  6QFE_A;  6QFE_B;  1G3D_A;  1TNJ_A;  6BVH_A;  1S84_A;  1P57_B;  1H9I_E;  1BJU_A;  1TNK_A;  1UTJ_A;  1V2S_T;  2Z7F_E;  1G3C_A;  1QA0_A;  1TNG_A;  3AAU_A;  1V2N_T;  1G3B_A;  2CGA_A;  2CGA_B;  1AVW_A;  4D76_A;  1QCP_A;  1JRS_A;  1QB9_A;  2STB_E;  1HNE_E;  2TGT_A;  5FXL_A;  1Y3W_A;  3TGI_E;  6B6T_A;  6B6Q_A;  1F2S_E;  6B6R_A;  1MAY_A;  6B6N_A;  5YJM_A;  4B1T_A;  4B1T_C;  1XUJ_A;  1F0T_A;  3UNS_A;  6B6S_A;  6B6P_A;  4AG2_A;  4AG2_B;  1G3E_A;  1PPC_E;  5QTY_A;  1DIC_A;  1XUF_A;  1QB1_A;  4NZL_A;  6AOD_C;  1V6D_A;  1TAW_A;  1T8N_A;  1T8N_C;  1O5E_H;  3N7O_A;  1O32_A;  1GVL_A;  4TY6_A;  1O2H_A;  4CRA_A;  1TGS_Z;  1ZZZ_A;  4Y8X_A;  1QBO_A;  1T32_A;  1V2W_T;  1FMG_A;  5ZFI_A;  1QB6_A;  1AZ8_A;  3BTH_E;  5A09_A;  1NN6_A;  1BTZ_A;  1V2U_T;  1K2I_1;  1CGH_A;  2ZPR_A;  2ZPR_B;  1P2M_A;  1P2M_C;  6D3X_A;  6D3X_B;  1CE5_A;  1TNI_A;  3V12_A;  5JYI_A;  1O5F_H;  6SHI_A;  6SHI_B;  6SHI_C;  6SHI_D;  6SHI_E;  6SHI_F;  6SHI_G;  6SHI_H;  1S82_A;  1TPS_A;  4CBN_A;  4CBN_B;  2ZDM_A;  3T27_A;  5A8Y_A;  2STA_E;  1SLU_B;  1TNL_A;  7BS0_A;  3BTF_E;  3V0X_A;  4AFU_A;  4AFU_B;  1BJV_A;  1TON_A;  1PPH_E;  2TGA_A;  6QHB_A;  6QHB_B;  5NBA_A;  6W50_A;  3Q76_A;  3Q76_B;  1MTV_A;  1MTW_A;  4DGJ_A;  4DGJ_B;  4DGJ_C;  4DGJ_D;  1P2N_A;  1P2N_C;  3BTM_E;  1K1P_A;  2RG3_A;  1T8M_A;  1T8M_C;  1Z7K_A;  1F0U_A;  3UQO_A;  5NX1_A;  2ZDN_A;  4X6P_A;  4X6P_B;  4O9V_A;  1G36_A;  6QMT_A;  6QMT_B;  1NC6_A;  2BZA_A;  1TPA_E;  1OYQ_A;  1P2Q_A;  1P2Q_C;  4CRB_A;  1PPE_E;  5FCK_A;  4NFE_A;  1BIT_A;  6AVL_A;  1MTS_A;  1MTU_A;  6N4T_A;  1T7C_A;  1T7C_C;  1MAX_A;  3BTE_E;  2BDG_A;  2BDG_B;  1KLT_A;  1L2E_A;  3PYH_A;  5F8T_A;  1AU8_A;  1ZHM_A;  3Q77_A;  2ZHD_A;  1GCD_A;  2PTC_E;  2TIO_A;  3BTK_E;  1ZSJ_A;  5QQO_A;  1OX1_A;  1GBT_A;  4AFS_A;  3VFE_A;  5NB6_A;  3RP2_A;  3RP2_B;  1K1O_A;  6QHA_A;  6QHA_B;  6QHC_A;  6QHC_B;  1V2V_T;  2ZPQ_A;  2ZPQ_B;  3TPI_Z;  3SOR_A;  1TIO_A;  6SJU_A;  6SJU_B;  6SJU_C;  6SJU_D;  6SJU_E;  6SJU_F;  6SJU_G;  6SJU_H;  2EEK_A;  3BTQ_E;  1K1N_A;  6D3Z_A;  3BTD_E;  3BTT_E;  1TYN_A;  4AOQ_A;  4AOQ_B;  4AOQ_C;  4K5Z_A;  3VPK_A;  1LDT_T;  5ZFH_A;  1EJM_A;  1EJM_C;  1EJM_E;  5QTX_A;  1ZSK_A;  1T31_A;  3UUZ_A;  3UUZ_B;  3BTG_E;  4NFF_A;  1J15_A;  2TGP_Z;  4B2A_A;  4B2A_C;  1ZR0_A;  1ZR0_C;  3DFL_A;  5C67_A;  5C67_B;  1AN1_E;  1EB2_A;  1SLW_B;  3S0N_A;  1YF4_A;  2QXH_A;  1XUH_A;  2ANW_A;  1YYY_1;  6DWF_A;  6DWF_B;  6DWF_C;  6DWF_D;  6DWF_E;  6DWF_F;  4ISO_A;  1CO7_E;  1JIR_A;  5QQP_A;  1J17_T;  1V2T_T;  3SO3_A;  2FDA_A;  1DSU_A;  1DSU_B;  6BX8_A;  6BX8_C;  6BX8_E;  6BX8_G;  5A0C_A;  5A0C_B;  4DOQ_A;  4DOQ_C;  4DOQ_E;  4JZ1_A;  1V2J_T;  1AVX_A;  2A7H_A;  6SHH_A;  6SHH_B;  6SHH_C;  6SHH_D;  6SHH_E;  6SHH_F;  6SHH_G;  6SHH_H;  6DWH_A;  6DWH_B;  6DWH_C;  6DWH_D;  6DWH_E;  6DWH_F;  3T62_A;  3T62_B;  3T62_C;  1V2K_T;  5XWL_A;  5XWL_B;  1V2P_T;  5A8Z_A;  1AUJ_A;  1O3A_A;  1DDJ_A;  1DDJ_B;  1DDJ_C;  1DDJ_D;  3P8F_A;  5TKU_A;  3W94_A;  3W94_B;  5TKT_A;  4R0I_A;  1YP9_A;  4J2Y_B;  4X6N_A;  1ANC_A;  1ZMJ_A;  5Q0D_A;  4TY7_A;  1BRA_A;  2ZGC_A;  5Q0E_A;  3BTW_E;  4CR5_A;  5E2O_A;  2GV6_A;  2TGD_A;  3QK1_A;  1K1M_A;  4OGY_A;  4OGY_B;  1AQ7_A;  4X6O_A;  1NPM_A;  1NPM_B;  1PPG_E;  1K1I_A;  1LQE_A;  1ZTJ_A;  1GL1_A;  1GL1_B;  1GL1_C;  1DST_A;  1K1J_A;  1ZPB_A;  1SMF_E;  5Q0F_A;  1FXY_A;  4TPI_Z;  4CRD_A;  5EXM_A;  1D6R_A;  5J4S_A;  4JYT_A;  1ZMN_A;  1SLX_B;  4JZI_A;  5QTV_A;  1ANE_A;  1BTP_A;  6QMR_A;  6QMR_B;  6QMR_C;  6QMR_D;  6QMR_E;  6QMR_F;  1BRB_E;  6FID_A;  2D8W_A;  1TRN_A;  1TRN_B;  1K9O_E;  1FIW_A;  1QL7_A;  2TPI_Z;  1TRM_A;  1TRM_B;  1AND_A;  5A0B_A;  1P2O_A;  1P2O_C;  5QCL_A;  5A8X_A;  1FDP_A;  1FDP_B;  1FDP_C;  1FDP_D;  1PJP_A;  1BZX_E;  6R8X_A;  6SKC_A;  6SKC_B;  1DFP_A;  1DFP_B;  2ILN_A;  2ILN_B;  1QRZ_A;  1QRZ_B;  1QRZ_C;  1QRZ_D;  4O97_A;  4AFZ_A;  4AFZ_B;  5QTT_A;  2QXJ_A;  1G9I_E;  1DLK_B;  1DLK_D;  1IAU_A;  1HFD_A;  3RDZ_A;  3RDZ_B;  5NX3_A;  2GV7_A;  3TGJ_E;  4WXV_A;  4WXV_B;  1OXG_A;  5Y9L_A;  4K2Y_A;  4CRF_A;  5QTW_A;  4ISL_A;  1ZSL_A;  1V2Q_T;  2CMY_A;  3UQV_A;  4D9Q_A;  4D9Q_B;  2ZGH_A;  1EZS_C;  1EZS_D;  4AN7_A;  1H1B_A;  1H1B_B;  1QL9_A;  5E2P_A;  4Q2K_A;  4Q2K_B;  4Q2K_C;  4Q2K_D;  1OPH_B;  1ZRK_A;  1S85_A;  1ZML_A;  1RJX_B;  5QCN_A;  1CGI_E;  1CGJ_E;  5EXL_A;  1EUF_A;  5QCM_A;  3L3T_A;  3L3T_B;  3L3T_C;  3L3T_D;  1ZOM_A;  5MS4_A;  5MS4_B;  5MS4_C;  5MS4_D;  1TAB_E;  3BN9_A;  3BN9_B;  6E69_A;  6E69_B;  6E69_C;  6E69_D;  3M35_A;  6QH9_A;  6QH9_B;  1K1L_A;  1FI8_A;  1FI8_B;  1BRC_E;  1TX6_A;  1TX6_B;  1TX6_C;  1TX6_D;  2F3C_E;  6ZOV_A;  6ZOV_B;  6ZOV_C;  6ZOV_D;  6FUG_A;  6FUG_B;  6FUG_C;  6FUG_D;  6FUG_E;  6FUG_F;  5Q0H_A;  1L4D_A;  4OGX_A;  6C0S_A;  6Y4S_A;  6Y4S_B;  6Y4S_C;  3VEQ_B;  6FUJ_A;  6FUJ_B;  6FUJ_C;  6FUJ_D;  6FUJ_E;  6FUJ_F;  1ORF_A;  2PSY_A;  5WB6_A;  1J14_A;  4X6M_A;  1TFX_A;  1TFX_B;  5J4Q_A;  3MYW_A;  3MYW_B;  1XX9_A;  1XX9_B;  5QTU_A;  1AMH_A;  1AMH_B;  6SKD_A;  6SKD_B;  4Y8Z_A;  2RDL_A;  2RDL_B;  2PSX_A;  2TLD_E;  5MS3_A;  4U30_A;  4U30_B;  4U30_C;  4U30_D;  1ZLR_A;  5YJK_A;  4KGA_A;  4KGA_B;  1MZA_A;  3E8L_A;  3E8L_B;  3L33_A;  3L33_B;  3L33_C;  3L33_D;  4NA8_A;  4WXI_A;  4D7G_A;  3TK9_A;  1EKB_B;  2TRM_A;  1EZU_C;  1EZU_D;  4D9R_A;  4D9R_B;  3I29_A;  5Q0G_A;  6KD5_B;  4ISN_A;  4Q7X_A;  4Q7X_B;  2ZGJ_A;  6Q1U_A;  6Q1U_B;  5QCK_A;  1ANB_A;  6F5M_A;  6F5M_B;  1AO5_A;  1AO5_B;  3G01_A;  3G01_B;  6TS7_A;  6GFI_A;  6GFI_B;  1ZTK_A;  3SOS_A;  4Y8Y_A;  5LYO_A;  5LYO_B;  5LYO_C;  3FZZ_A;  3FZZ_B;  3TJV_A;  1ZPC_A;  1OP8_A;  1OP8_B;  1OP8_C;  1OP8_D;  1OP8_E;  1OP8_F;  1EZX_C;  1EJA_A;  1ZPZ_A;  4Q7Y_A;  2QYI_A;  2QYI_C;  1ZTL_A;  1BUI_A;  1BUI_B;  1B0F_A;  3T28_A;  6B6O_A;  6SMA_A;  6SMA_B;  6SMA_C;  1ZJD_A;  1C9P_A;  1ZHP_A;  5GVT_A;  5GVT_B;  6TWB_A;  6TWB_H;  1XXF_A;  1XXF_B;  1GL0_E;  4NIY_A;  4NIY_B;  4NIY_C;  4NIY_D;  5LPE_A;  5LPE_B;  3UIR_A;  3UIR_B;  2ZCH_P;  2ZKS_A;  6DZF_A;  6A8O_A;  6A8O_B;  1BML_A;  1BML_B;  5LPF_A;  5LPF_B;  1QL8_A;  1EAW_A;  1EAW_C;  3BSQ_A;  3BSQ_B;  3BSQ_C;  2HVX_A;  6HHC_A;  3TJU_A;  4Q80_A;  4Q80_B;  1L4Z_A;  5GIB_A;  5GIB_B;  6TWC_A;  1FIZ_A;  3GYM_A;  3GYM_B;  1EX3_A;  1MZD_A;  2QXG_A;  2QXG_B;  2Y6T_A;  2Y6T_B;  2Y6T_C;  2Y6T_D;  2XWA_A;  2XWA_B;  4NA7_A;  4KP0_A;  1XXD_A;  1XXD_B;  3QUM_P;  3QUM_Q;  2ZCL_P;  3UY9_A;  3UY9_B;  3UY9_C;  3UY9_D;  3UY9_E;  3UY9_F;  3UY9_G;  3UY9_H;  3UY9_I;  3UY9_J;  3UY9_K;  3UY9_L;  3UY9_M;  3UY9_N;  3UY9_O;  3UY9_P;  2BDH_A;  2BDH_B;  2BDH_C;  2BDH_D;  2ZCK_P;  1FQ3_A;  1FQ3_B;  1C9T_A;  1C9T_B;  1C9T_C;  1C9T_D;  1C9T_E;  1C9T_F;  2XWB_I;  2XWB_J;  5TCA_A;  5TCA_B;  5TCA_C;  5TCA_D;  5TCA_E;  5TCA_F;  5TCA_G;  5GXP_A;  5GXP_B;  2QN5_T;  2BDI_A;  2BDI_B;  2BDI_C;  2BDI_D;  2BDI_E;  2BDI_F;  2BDI_G;  2BDI_H;  2BDI_I;  2BDI_J;  2BDI_K;  2BDI_L;  2BDI_M;  2BDI_N;  2BDI_O;  2BDI_P;  1SGF_A;  1SGF_X;  1SGF_G;  1SGF_Z;  4GAW_A;  4GAW_B;  4GAW_C;  4GAW_D;  4GAW_E;  4GAW_F;  4GAW_G;  4GAW_H;  4GAW_I;  4GAW_J;  4GAW_K;  4GAW_L;  5TCC_A;  5TCC_B;  5TCC_C;  5TCC_D;  5TCC_E;  5TCC_F;  5TCC_G;  1KYN_A;  1KYN_B;  6DWU_AA;  6DWU_AC;  6DWU_AE;  6DWU_AG;  6DWU_AI;  6DWU_AK;  6DWU_AM;  6DWU_AO;  6DWU_AQ;  6DWU_AS;  6DWU_AU;  6DWU_BA;  6DWU_BC;  6DWU_BE;  6DWU_BG;  6DWU_BI;  6DWU_BK;  6DWU_BM;  6DWU_BO;  6DWU_BQ;  6DWU_BS;  6DWU_BU;  6DWU_CA;  6DWU_CC;  6DWU_CE;  6DWU_CG;  6DWU_CI;  6DWU_CK;  6DWU_CM;  6DWU_CO;  6DWU_CQ;  6DWU_CS;  6DWU_CU;  6DWU_DA;  6DWU_DC;  6DWU_DE;  6DWU_DG;  6DWU_DI;  6DWU_DK;  6DWU_DM;  6DWU_DO;  6DWU_DQ;  6DWU_DS;  6DWU_DU;  1CHG_A;  5NAT_A;  5MNX_A;  5MNY_A;  5MNZ_A;  5MO0_A;  5MO1_A;  5MO2_A;  5K7R_A;  1FUJ_A;  1FUJ_B;  1FUJ_C;  1FUJ_D;  2TBS_A;  1NTP_A;  1TGC_A;  1TGN_A;  1TGB_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling