1AKSAB

Crystal structure of the first active autolysate form of the porcine alpha trypsin
A: 34-37,67-69,125-127,130-132 B: 204-209,217-219
Link type Probability Chain A piercings Chain B piercings
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
view details
Hopf.2 Hopf.2 45% -156B +215B -245B +16A -30A -139A
Interpreting sequences
Chain A Sequence
IVGGYTCAANSIPYQVSLN--SGSHFCGGSLINSQWVVSAAHCYKSRIQVRL-GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPR-SCAA-AGTECLISGWGNTK
Chain A Sequence
SSGSSYPSLLQCLKAPVLSNSSCKSSYPGQITGNMICVGFLQGGKDSCQGDSGGPVVCN----GQLQGIVSW-GYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
sequence length 125,98
structure length 125,98
publication title The first structure at 1.8 A resolution of an active autolysate form of porcine alpha-trysoin.
pubmed doi rcsb
molecule tags Serine protease
molecule keywords ALPHA TRYPSIN
missing residues A: 34-37,67-69,125-127,130-132 B: 204-209,217-219
ec nomenclature ec 3.4.21.4: Trypsin.
ec 3.4.21.4: Trypsin.
pdb deposition date1996-07-24
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF00089 TrypsinTrypsin
AB PF00089 TrypsinTrypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aksA00
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aksB00
1SLVAB 1AQ7AB 3FP7EJ 1AKSAB 3FP7EI 3FP7EIJ
chains in the LinkProt database with same CATH superfamily
1SLVAB 1AQ7AB 3FP7EJ 1AKSAB 3FP7EI 3FP7EIJ
chains in the LinkProt database with same CATH topology
1SLVAB 1AQ7AB 3FP7EJ 1AKSAB 3FP7EI 3FP7EIJ
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 1SLV AB;  1AQ7 AB;  3FP7 EJ;  1AKS AB;  3FP7 EI;  3FP7 EIJ; 
#chains in the LinkProt database with same CATH topology
 1SLV AB;  1AQ7 AB;  3FP7 EJ;  1AKS AB;  3FP7 EI;  3FP7 EIJ; 
#chains in the LinkProt database with same CATH homology
 1SLV AB;  1AQ7 AB;  3FP7 EJ;  1AKS AB;  3FP7 EI;  3FP7 EIJ; 

1YPHC 1YPHD 1GG6B 1GGDB 2P8OB 1GCTB 3GCTF 3RU4D 1AB9B 3VGCB 1CHOF 2GCTB 5XW1A 1AFQB 5XWAA 2GMTB 7GCHF 6CHAB 6CHAF 5XW8A 1GHBF 6DI8B 6DI8E 6DI8H 6DI8K 2GCHF 2VGCB 5XW9A 1VGCB 3GCHB 4GCHF 6GCHF 1N8OB 1GHAF 1GMHF 4VGCB 1GMCF 1GMDF 1UHBA 1CA0B 1CA0G 1HJAB 5GCHF 3BG4B 1CBWB 1CBWG 2JETB 1KDQA 1MTNB 1MTNF 8GCHF 5CHAB 5CHAF 4CHAB 4CHAF 2CHAB 2CHAF 1YPHE 1YPHF 1GG6C 1GGDC 2P8OC 1GCTC 3GCTG 3RU4E 1AB9C 3VGCC 1CHOG 2GCTC 5XW1B 1AFQC 5XWAB 1EPTC 2GMTC 7GCHG 6CHAC 6CHAG 5XW8B 1GHBG 6DI8C 6DI8F 6DI8I 6DI8L 2GCHG 2VGCC 5XW9B 1VGCC 3GCHC 4GCHG 6GCHG 1N8OC 1GHAG 1GMHG 4VGCC 1GMCG 1GMDG 1UHBB 1CA0C 1CA0H 1HJAC 5GCHG 3BG4C 1CBWC 1CBWH 2JETC 1KDQB 1MTNC 1MTNG 8GCHG 5CHAC 5CHAG 4CHAC 4CHAG 2CHAC 2CHAG
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1YPH_C;  1YPH_D;  1GG6_B;  1GGD_B;  2P8O_B;  1GCT_B;  3GCT_F;  3RU4_D;  1AB9_B;  3VGC_B;  1CHO_F;  2GCT_B;  5XW1_A;  1AFQ_B;  5XWA_A;  2GMT_B;  7GCH_F;  6CHA_B;  6CHA_F;  5XW8_A;  1GHB_F;  6DI8_B;  6DI8_E;  6DI8_H;  6DI8_K;  2GCH_F;  2VGC_B;  5XW9_A;  1VGC_B;  3GCH_B;  4GCH_F;  6GCH_F;  1N8O_B;  1GHA_F;  1GMH_F;  4VGC_B;  1GMC_F;  1GMD_F;  1UHB_A;  1CA0_B;  1CA0_G;  1HJA_B;  5GCH_F;  3BG4_B;  1CBW_B;  1CBW_G;  2JET_B;  1KDQ_A;  1MTN_B;  1MTN_F;  8GCH_F;  5CHA_B;  5CHA_F;  4CHA_B;  4CHA_F;  2CHA_B;  2CHA_F;  1YPH_E;  1YPH_F;  1GG6_C;  1GGD_C;  2P8O_C;  1GCT_C;  3GCT_G;  3RU4_E;  1AB9_C;  3VGC_C;  1CHO_G;  2GCT_C;  5XW1_B;  1AFQ_C;  5XWA_B;  1EPT_C;  2GMT_C;  7GCH_G;  6CHA_C;  6CHA_G;  5XW8_B;  1GHB_G;  6DI8_C;  6DI8_F;  6DI8_I;  6DI8_L;  2GCH_G;  2VGC_C;  5XW9_B;  1VGC_C;  3GCH_C;  4GCH_G;  6GCH_G;  1N8O_C;  1GHA_G;  1GMH_G;  4VGC_C;  1GMC_G;  1GMD_G;  1UHB_B;  1CA0_C;  1CA0_H;  1HJA_C;  5GCH_G;  3BG4_C;  1CBW_C;  1CBW_H;  2JET_C;  1KDQ_B;  1MTN_C;  1MTN_G;  8GCH_G;  5CHA_C;  5CHA_G;  4CHA_C;  4CHA_G;  2CHA_C;  2CHA_G; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling