3HPLAB

Kcsa e71h-f103a mutant in the closed state
Link type Probability Chain A piercings Chain B piercings
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
view details
Unlink Unlink 54% -82B +213B +5A -22A +35A +78A -95A +110A -127A +145A -155A +170A -183A -220A
Interpreting sequences
Chain A Sequence
QVQLQQPGAELVKPGASVKLSCKASGYTFTSDWIHWVKQRPGHGLEWIGEIIPSYGRANYNEKIQKKATLTADKSSSTAFMQLSSLTSEDSAVYYCARERGDGYFAVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRD
Chain A Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
sequence length 219,212
structure length 219,212
publication title Structural basis for the coupling between activation and inactivation gates in K(+) channels.
pubmed doi rcsb
molecule tags Immune system/metal transport
molecule keywords Antibody Fab heavy chain
source organism Streptomyces lividans
pdb deposition date2009-06-04
LinkProt deposition date2016-08-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hplA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hplA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hplB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hplB01
3HPJBDE 1AGBAC 3E2HABQ 1ZLWHLM 3FT3AP 1OP3HKL 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3IXADF 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3GJFDF 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 1AGBABC 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3HAEHL 1A9BBDF 3HPJDEF 1AHWDE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3JTTDEI 3JTTAEI 1ZLUKLM 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HNVHL 1OP3HM 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 1Q8MBC 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 1A1MAC 3E3QeF 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1Q8MCD 3FOMAB 3HPJACE 3H9SACD 3FT4AP 1ZLVHL 2VSCAC 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3H9HABC 1OP5HL 3FONCD 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HAEDFK 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IVKBL 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3EFFAM 3FQRABC 3DX8ABC 3HCVAB 3HAEST 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3DXAAKM 3GJFEH 1A9BAB 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3HAEPQR 3IVKAH 3HG1ABC 1AGFAC 1OP3HLM 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JTTCGH 3GIZHL 3GSWABP 1AGCABC 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 1ZLULM 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3E3QBCG 3FFCACF 3H9HACD 3GSNAB 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3DXAFH 3F7YAB 1OP3HKM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 3E3QADQ 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3HC3HL 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3DX9CD 1OP5KM 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1AIFHL 3HAEJMO 3FCTAB 3JTTAGH 3H7BDF 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1OP5HKLM 3E3QPST 3H9SACE 3HG1ACD 3FFCAC 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3GIVADE 1ZLUHKLM 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 3GSOAB 3FRUAD 1OM3HK 3JTTCDF 1AGFAB 3GJEABL 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3E3QDE 3DXAEJ
chains in the LinkProt database with same CATH superfamily
3HPJBDE 1AGBAC 3H4FABC 3E2HABQ 1ZLWHLM 3KDPABC 1OP3HKL 1SLVAB 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3JWNHLM 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3FT3AP 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3H4HBC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 3JTTDG 3JWNCGK 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FCSBC 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3JWNFIK 3HAEHL 1A9BBDF 3E3QBCG 1AHWDE 1UT1DE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 3HG1ABC 3H9SACE 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3FCSABC 3JTTAEI 1ZLUKLM 1Q8MBC 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HPJDEF 3HNVHL 3JWNIKN 3H4FBC 1OP3HM 3JTTDGH 3JWNFGN 1AGBABC 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 3FONCD 1UT1CF 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 3GEFACD 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3K5SAB 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3GEFAB 3H4HAB 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 3GIVADE 1A1MAC 3E3QeF 1UT1AD 3KDPCDG 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3JWNCFN 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1GMECD 3FOMAB 3KDPABD 3JWNHIL 2W5PAB 3FT4AP 1ZLVHL 2VSCAC 1UT1ADE 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3GEFBCD 1ZXKAB 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3JWNIKL 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3H4FAC 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3GJFDF 3H9HABC 1OP5HL 3GSNAB 3JWNHMN 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HPJACE 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IXADF 3FCSAB 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3JWNEHK 3EFFAM 3FQRABC 3JWNCEH 3DX8ABC 3HCVAB 3HAEST 3JWNCFL 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3JWNGHM 3H9SABC 3FCSAD 3JWNHLN 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3JWNHN 3DXAAKM 3GJFEH 3GEFCD 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FCSBCD 3FQNABC 3GEFABC 3H4HABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3JWNCGH 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3DX7AB 3HAEPQR 3IVKAH 3JWNEHN 1AGFAC 3JWNCEM 3HAEDFM 1A9BACF 3FQTAC 3FCSCD 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3KDPACD 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JWNGH 3JTTCGH 3GIZHL 3GSWABP 3GEFBD 1UT1BF 1AGCABC 1ZVNAB 3FCSABD 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3JWNGN 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3GEFABD 3JWNIK 1ZLULM 3GSRAP 3H7BDEF 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3JWNCEL 3FFCACF 3H9HACD 3DXAACK 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3GEFAD 3F7YAB 1OP3HKM 1OP3HLM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 1Q8MCD 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 1UT1BC 3E3QADQ 3JWNCEK 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3H9SACD 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3KDPABG 3JWNHIK 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3JWNIKM 3HC3HL 3JWNGHI 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3H4FAB 3JWNMN 3DXAFH 3KDPAB 3E3Qcdf 3JWNLMN 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3KDPCD 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 2W5PABC 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3FCSACD 3JWNCGL 3DX9CD 3H4HAC 2W5PBC 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1UT1AE 1AIFHL 3JWNEFH 3FCTAB 3JTTAGH 3JWNGIK 3H7BDF 3GEFBC 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3GEFAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1A9BAB 1OP5HKLM 1OP5KM 3E3QPST 3JWNHIM 3HG1ACD 3FFCAC 1GMEAB 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3JTTDEI 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3KDPBCH 1ZLUHKLM 3FRUEF 1A9BDF 3JWNCE 3FFCACE 3GSWAP 3IXAAD 3IVKBL 3JWNFHL 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3KDPCDH 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 3JWNCGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 1QEXAB 3HAEJMO 3GSOAB 3FRUAD 1OM3HK 1UT1BCF 3HAEDFK 3JTTCDF 1AGFAB 3GJEABL 3JWNCEN 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3JWNCGN 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 2W5PAC 3FCSAC 3KDPABH 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3JWNCEG 3KDPBCG 3E3QDE 3DXAEJ 3JWNGMN 3JWNCFM
chains in the LinkProt database with same CATH topology
3HPJBDE 1AGBAC 3E2HABQ 1ZLWHLM 3FT3AP 1OP3HKL 3DXAKM 3H9HBDF 3DXADE 3DX7AC 3DXAACD 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAEIJ 3IXADF 3DXAFG 3H9SCD 3FB6AB 1A9BAC 1ZLVKM 3GJFDF 3GJEAHL 3DXAABC 3HAEJKM 3E3Qde 3H7BACE 1ZLUHKM 1A1MABC 3HAEABC 1ZLWKLM 3HAEDFG 3E3QBFG 1AGBABC 3DSFHL 1ZLUHM 3FQRAC 3G5YAB 1A1OAC 3FJTAB 3GSNHP 3E3QEW 3FMGHL 3E3QHIK 3FFCFH 1AGEAC 3HAEHL 1A9BBDF 3HPJDEF 1AHWDE 3EOTHL 3GSUAB 3GSOAP 3HNSHL 3GJFHL 3FQTAB 3HAEDE 1ZLUKM 3E3QPRT 3HAEACL 1A64AB 3DXAIKM 3FRUCD 1AFVHL 3IXACDF 1A1NABC 3EFFAN 3HAEGI 1OP5HLM 3JTTDEI 3JTTAEI 1ZLUKLM 3FQNAC 3HAEACG 3E3QCF 1AGDAC 3DX8AB 3HCVABC 3HNVHL 1OP3HM 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3HAENO 3FFCABC 1Q8MBC 1OP5LM 3EFFBM 3H9HDF 1A9EAB 1AHWAF 3HPJAB 1OP3KM 1ZLWHL 1OM3HL 1A5FHL 3HAEHO 3HPJADF 3IVKAL 1ZLWLM 3IXAABD 1CDCAB 2VSCCD 3JTTACI 3EFDKL 1A9BABC 3FQUAB 3HAEDFI 3FQXAB 3FFCDE 3H7BAB 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 3HAELN 3IVKABL 1A1MAC 3E3QeF 1NQBAC 1AFVKM 3H7BDE 3H7BABD 1ZLVLM 3FQWAC 3HAEGT 3IVKBH 1ZLUHK 3E3QDHK 3E3QUWX 2VSCACD 3DX9ACD 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 1Q8MCD 3FOMAB 3HPJACE 3H9SACD 3FT4AP 1ZLVHL 2VSCAC 1OP5HKM 3JTTCDI 3FB5AB 3GIVADF 3HAEPQ 3GSVAP 3DX9AB 3GSNAHP 1OM3HLM 3GJEAH 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3FB7AB 3DX6AB 3FRUABD 1ZLWHKLM 3JTTDE 3DXAACH 3DXAIJ 1AGDABC 3GSXAP 3IGAAB 3IXAACD 3E3Qcef 3E3QaZ 3JTTGH 3EFDHL 3DX7ABC 1ZLVHKM 3E3QRS 3JTTAB 3DXAKMO 1OP3LM 3H9HABC 1OP5HL 3FONCD 3FRUABC 3JTTCDG 3HAEGJK 1A8JHL 3FFCCFH 3HAEIK 3E3QUVX 3JTTEFH 3JTTDEG 3HAEDFK 3GSVAB 2VSCBCD 3DXAJKM 1A1NAB 3H9HDEF 3GB7AB 3FT3AB 3JTTADE 3GIVABD 3IVKBL 3H7BADF 3H9HAC 1Q8MABD 3E3QMN 3HAEJMN 3GSOABP 3JTTBDE 3GSQAB 3JTTAGI 1OP3KLM 3EFFAM 3FQRABC 3DX8ABC 3HCVAB 3HAEST 3E3QAEQ 1ZLWHKM 3GIVDEF 3HFMHL 3HAEACH 1OM3HKM 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3GJEBHL 3FFCFG 1WWAXY 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3GIVAD 1A9EABC 3HPJABC 3HPLAB 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 1ZLSHL 3DXAAKM 3GJFEH 1A9BAB 3FFCFHI 3FQXABC 3HG1DE 3DXADEJ 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3H9HAD 3IXAADE 3DXAFGH 1AIFAB 3GJFDEF 3GJFDFK 1Q8MAB 3GIVACD 3GJFAB 1ZLUHL 3EYUHL 1ZLUHLM 3FFCBFH 3HAEPQR 3IVKAH 3HG1ABC 1AGFAC 1OP3HLM 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3EFFCK 3HLAAB 3GSNHL 3FT2ABP 3IVKHL 3HAEHLO 3FOLAB 1OP5KLM 3JTTBDG 1OM3KL 3JTTCGH 3GIZHL 3GSWABP 1AGCABC 1AQKHL 1OM3KLM 1Q8MAD 3GJFDEH 3JTTAC 3DXANO 3DX6ABC 3EFFCD 3F7VAB 1ZLVHLM 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 1ZLULM 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3GJEBL 3JTTABC 2VSCABC 1OP5HM 3E3QBCG 3FFCACF 3H9HACD 3GSNAB 3IXAAC 3GJEAL 3HNTHL 3H9HDE 1OP3HKLM 1A9EAC 3GK8HL 3DXAFH 3F7YAB 1OP3HKM 1ZLWHK 3GIVAC 3GSVABP 2VSCBC 3IXAABE 3DXAACL 3GJEABH 3H9HAB 3FQXAC 3H7BACD 3JTTACH 1AIFAHL 1AIFAL 3FONCE 3H7BAC 3FT4ABP 3FQRAB 3HAEDFN 1A1OAB 1A9BCDF 3GIVABC 3HAELO 3EYSHL 3GSXABP 1Q8MABC 3IXABDF 1AGEAB 3GSRAB 3JTTBFH 3E3QADQ 3FQWAB 3FT4AB 1Q8MABCD 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FRUAB 1ZLWHM 2VSCABCD 3GSUABP 1ZLVHM 3FONAB 1OP3HK 3GSNBHP 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3HC3HL 1OP3HL 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 1ZLUHKL 3EFDHK 3GJFKM 3EFFBN 3GJEAB 3HPJAC 1Q8MBCD 3GSQAP 3FONAP 1A1NAC 1OM3HM 1ZLWKM 3HPJADE 3IXAABC 3GJFACH 3HAELNO 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3DX9CD 1OP5KM 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1Q8MACD 1A1MAB 1AIFHL 3HAEJMO 3FCTAB 3JTTAGH 3H7BDF 3EFFAB 1OM3HKLM 3IXADE 3HCVAC 3IVKABH 1ZLWHKL 3HG1AC 3EFFDL 1OM3HKL 1OP5HKLM 3E3QPST 3H9SACE 3HG1ACD 3FFCAC 3FQTABC 1ZLVHK 2VSCAB 3JTTAFG 3HAEPRS 3FOLAP 1OP5HKL 3EFFAK 3FT2AB 3DXAACF 3GIVADE 1ZLUHKLM 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3FB8AB 3GIVDE 1AHWAB 3HAEAC 3FOMAP 3H9SDE 3DX6AC 3DXADEI 3FOLABP 2VSCBD 1A1OABC 1ZLVHKLM 3GIVAB 3FFCIJ 3GJFDFM 3GJEBH 3JTTAD 3FONACE 3JTTGI 1AGEABC 3GJFAC 1ZLVHKL 3GSRABP 3GSOAB 3FRUAD 1OM3HK 3JTTCDF 1AGFAB 3GJEABL 1ZLVKLM 3JTTDEF 1OP5HK 3FONABP 3EFFCL 3GJEHL 3DXAFHJ 3EFFDK 3FFCACI 3E3QIJ 3E3QVW 2VSCABD 3FQUABC 3JTTBDF 1OM3KM 3IVKAB 3DXADKM 3DXAEFH 3H7BABC 3DXADJ 3E3QDE 3DXAEJ
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  1ZLW HLM;  3FT3 AP;  1OP3 HKL;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3IXA DF;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3GJF DF;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3HAE HL;  1A9B BDF;  3HPJ DEF;  1AHW DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3JTT DEI;  3JTT AEI;  1ZLU KLM;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HNV HL;  1OP3 HM;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  1Q8M BC;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  1A1M AC;  3E3Q eF;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1Q8M CD;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  1ZLV HL;  2VSC AC;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3H9H ABC;  1OP5 HL;  3FON CD;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HAE DFK;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IVK BL;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3EFF AM;  3FQR ABC;  3DX8 ABC;  3HCV AB;  3HAE ST;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3DXA AKM;  3GJF EH;  1A9B AB;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3HAE PQR;  3IVK AH;  3HG1 ABC;  1AGF AC;  1OP3 HLM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JTT CGH;  3GIZ HL;  3GSW ABP;  1AGC ABC;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  1ZLU LM;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3E3Q BCG;  3FFC ACF;  3H9H ACD;  3GSN AB;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3DXA FH;  3F7Y AB;  1OP3 HKM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  3E3Q ADQ;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3HC3 HL;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3DX9 CD;  1OP5 KM;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1AIF HL;  3HAE JMO;  3FCT AB;  3JTT AGH;  3H7B DF;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1OP5 HKLM;  3E3Q PST;  3H9S ACE;  3HG1 ACD;  3FFC AC;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3GIV ADE;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  3GSO AB;  3FRU AD;  1OM3 HK;  3JTT CDF;  1AGF AB;  3GJE ABL;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3E3Q DE;  3DXA EJ; 
#chains in the LinkProt database with same CATH topology
 3HPJ BDE;  1AGB AC;  3H4F ABC;  3E2H ABQ;  1ZLW HLM;  3KDP ABC;  1OP3 HKL;  1SLV AB;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3JWN HLM;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3FT3 AP;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3H4H BC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  3JTT DG;  3JWN CGK;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FCS BC;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3JWN FIK;  3HAE HL;  1A9B BDF;  3E3Q BCG;  1AHW DE;  1UT1 DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  3HG1 ABC;  3H9S ACE;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3FCS ABC;  3JTT AEI;  1ZLU KLM;  1Q8M BC;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HPJ DEF;  3HNV HL;  3JWN IKN;  3H4F BC;  1OP3 HM;  3JTT DGH;  3JWN FGN;  1AGB ABC;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  3FON CD;  1UT1 CF;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  3GEF ACD;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3K5S AB;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3GEF AB;  3H4H AB;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  3GIV ADE;  1A1M AC;  3E3Q eF;  1UT1 AD;  3KDP CDG;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3JWN CFN;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1GME CD;  3FOM AB;  3KDP ABD;  3JWN HIL;  2W5P AB;  3FT4 AP;  1ZLV HL;  2VSC AC;  1UT1 ADE;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3GEF BCD;  1ZXK AB;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3JWN IKL;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3H4F AC;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3GJF DF;  3H9H ABC;  1OP5 HL;  3GSN AB;  3JWN HMN;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HPJ ACE;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IXA DF;  3FCS AB;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3JWN EHK;  3EFF AM;  3FQR ABC;  3JWN CEH;  3DX8 ABC;  3HCV AB;  3HAE ST;  3JWN CFL;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3JWN GHM;  3H9S ABC;  3FCS AD;  3JWN HLN;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3JWN HN;  3DXA AKM;  3GJF EH;  3GEF CD;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FCS BCD;  3FQN ABC;  3GEF ABC;  3H4H ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3JWN CGH;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3DX7 AB;  3HAE PQR;  3IVK AH;  3JWN EHN;  1AGF AC;  3JWN CEM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3FCS CD;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3KDP ACD;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JWN GH;  3JTT CGH;  3GIZ HL;  3GSW ABP;  3GEF BD;  1UT1 BF;  1AGC ABC;  1ZVN AB;  3FCS ABD;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3JWN GN;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3GEF ABD;  3JWN IK;  1ZLU LM;  3GSR AP;  3H7B DEF;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3JWN CEL;  3FFC ACF;  3H9H ACD;  3DXA ACK;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3GEF AD;  3F7Y AB;  1OP3 HKM;  1OP3 HLM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  1Q8M CD;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  1UT1 BC;  3E3Q ADQ;  3JWN CEK;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3H9S ACD;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3KDP ABG;  3JWN HIK;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3JWN IKM;  3HC3 HL;  3JWN GHI;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3H4F AB;  3JWN MN;  3DXA FH;  3KDP AB;  3E3Q cdf;  3JWN LMN;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3KDP CD;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  2W5P ABC;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3FCS ACD;  3JWN CGL;  3DX9 CD;  3H4H AC;  2W5P BC;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1UT1 AE;  1AIF HL;  3JWN EFH;  3FCT AB;  3JTT AGH;  3JWN GIK;  3H7B DF;  3GEF BC;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3GEF AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1A9B AB;  1OP5 HKLM;  1OP5 KM;  3E3Q PST;  3JWN HIM;  3HG1 ACD;  3FFC AC;  1GME AB;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3JTT DEI;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3KDP BCH;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3JWN CE;  3FFC ACE;  3GSW AP;  3IXA AD;  3IVK BL;  3JWN FHL;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3KDP CDH;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  3JWN CGI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  1QEX AB;  3HAE JMO;  3GSO AB;  3FRU AD;  1OM3 HK;  1UT1 BCF;  3HAE DFK;  3JTT CDF;  1AGF AB;  3GJE ABL;  3JWN CEN;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3JWN CGN;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  2W5P AC;  3FCS AC;  3KDP ABH;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3JWN CEG;  3KDP BCG;  3E3Q DE;  3DXA EJ;  3JWN GMN;  3JWN CFM; 
#chains in the LinkProt database with same CATH homology
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  1ZLW HLM;  3FT3 AP;  1OP3 HKL;  3DXA KM;  3H9H BDF;  3DXA DE;  3DX7 AC;  3DXA ACD;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA EIJ;  3IXA DF;  3DXA FG;  3H9S CD;  3FB6 AB;  1A9B AC;  1ZLV KM;  3GJF DF;  3GJE AHL;  3DXA ABC;  3HAE JKM;  3E3Q de;  3H7B ACE;  1ZLU HKM;  1A1M ABC;  3HAE ABC;  1ZLW KLM;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3DSF HL;  1ZLU HM;  3FQR AC;  3G5Y AB;  1A1O AC;  3FJT AB;  3GSN HP;  3E3Q EW;  3FMG HL;  3E3Q HIK;  3FFC FH;  1AGE AC;  3HAE HL;  1A9B BDF;  3HPJ DEF;  1AHW DE;  3EOT HL;  3GSU AB;  3GSO AP;  3HNS HL;  3GJF HL;  3FQT AB;  3HAE DE;  1ZLU KM;  3E3Q PRT;  3HAE ACL;  1A64 AB;  3DXA IKM;  3FRU CD;  1AFV HL;  3IXA CDF;  1A1N ABC;  3EFF AN;  3HAE GI;  1OP5 HLM;  3JTT DEI;  3JTT AEI;  1ZLU KLM;  3FQN AC;  3HAE ACG;  3E3Q CF;  1AGD AC;  3DX8 AB;  3HCV ABC;  3HNV HL;  1OP3 HM;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3HAE NO;  3FFC ABC;  1Q8M BC;  1OP5 LM;  3EFF BM;  3H9H DF;  1A9E AB;  1AHW AF;  3HPJ AB;  1OP3 KM;  1ZLW HL;  1OM3 HL;  1A5F HL;  3HAE HO;  3HPJ ADF;  3IVK AL;  1ZLW LM;  3IXA ABD;  1CDC AB;  2VSC CD;  3JTT ACI;  3EFD KL;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FQX AB;  3FFC DE;  3H7B AB;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  3HAE LN;  3IVK ABL;  1A1M AC;  3E3Q eF;  1NQB AC;  1AFV KM;  3H7B DE;  3H7B ABD;  1ZLV LM;  3FQW AC;  3HAE GT;  3IVK BH;  1ZLU HK;  3E3Q DHK;  3E3Q UWX;  2VSC ACD;  3DX9 ACD;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  1Q8M CD;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  1ZLV HL;  2VSC AC;  1OP5 HKM;  3JTT CDI;  3FB5 AB;  3GIV ADF;  3HAE PQ;  3GSV AP;  3DX9 AB;  3GSN AHP;  1OM3 HLM;  3GJE AH;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3FB7 AB;  3DX6 AB;  3FRU ABD;  1ZLW HKLM;  3JTT DE;  3DXA ACH;  3DXA IJ;  1AGD ABC;  3GSX AP;  3IGA AB;  3IXA ACD;  3E3Q cef;  3E3Q aZ;  3JTT GH;  3EFD HL;  3DX7 ABC;  1ZLV HKM;  3E3Q RS;  3JTT AB;  3DXA KMO;  1OP3 LM;  3H9H ABC;  1OP5 HL;  3FON CD;  3FRU ABC;  3JTT CDG;  3HAE GJK;  1A8J HL;  3FFC CFH;  3HAE IK;  3E3Q UVX;  3JTT EFH;  3JTT DEG;  3HAE DFK;  3GSV AB;  2VSC BCD;  3DXA JKM;  1A1N AB;  3H9H DEF;  3GB7 AB;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IVK BL;  3H7B ADF;  3H9H AC;  1Q8M ABD;  3E3Q MN;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3GSQ AB;  3JTT AGI;  1OP3 KLM;  3EFF AM;  3FQR ABC;  3DX8 ABC;  3HCV AB;  3HAE ST;  3E3Q AEQ;  1ZLW HKM;  3GIV DEF;  3HFM HL;  3HAE ACH;  1OM3 HKM;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3GJE BHL;  3FFC FG;  1WWA XY;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3GIV AD;  1A9E ABC;  3HPJ ABC;  3HPL AB;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  1ZLS HL;  3DXA AKM;  3GJF EH;  1A9B AB;  3FFC FHI;  3FQX ABC;  3HG1 DE;  3DXA DEJ;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3H9H AD;  3IXA ADE;  3DXA FGH;  1AIF AB;  3GJF DEF;  3GJF DFK;  1Q8M AB;  3GIV ACD;  3GJF AB;  1ZLU HL;  3EYU HL;  1ZLU HLM;  3FFC BFH;  3HAE PQR;  3IVK AH;  3HG1 ABC;  1AGF AC;  1OP3 HLM;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3EFF CK;  3HLA AB;  3GSN HL;  3FT2 ABP;  3IVK HL;  3HAE HLO;  3FOL AB;  1OP5 KLM;  3JTT BDG;  1OM3 KL;  3JTT CGH;  3GIZ HL;  3GSW ABP;  1AGC ABC;  1AQK HL;  1OM3 KLM;  1Q8M AD;  3GJF DEH;  3JTT AC;  3DXA NO;  3DX6 ABC;  3EFF CD;  3F7V AB;  1ZLV HLM;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  1ZLU LM;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3GJE BL;  3JTT ABC;  2VSC ABC;  1OP5 HM;  3E3Q BCG;  3FFC ACF;  3H9H ACD;  3GSN AB;  3IXA AC;  3GJE AL;  3HNT HL;  3H9H DE;  1OP3 HKLM;  1A9E AC;  3GK8 HL;  3DXA FH;  3F7Y AB;  1OP3 HKM;  1ZLW HK;  3GIV AC;  3GSV ABP;  2VSC BC;  3IXA ABE;  3DXA ACL;  3GJE ABH;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  1AIF AHL;  1AIF AL;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  3HAE DFN;  1A1O AB;  1A9B CDF;  3GIV ABC;  3HAE LO;  3EYS HL;  3GSX ABP;  1Q8M ABC;  3IXA BDF;  1AGE AB;  3GSR AB;  3JTT BFH;  3E3Q ADQ;  3FQW AB;  3FT4 AB;  1Q8M ABCD;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FRU AB;  1ZLW HM;  2VSC ABCD;  3GSU ABP;  1ZLV HM;  3FON AB;  1OP3 HK;  3GSN BHP;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3HC3 HL;  1OP3 HL;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  1ZLU HKL;  3EFD HK;  3GJF KM;  3EFF BN;  3GJE AB;  3HPJ AC;  1Q8M BCD;  3GSQ AP;  3FON AP;  1A1N AC;  1OM3 HM;  1ZLW KM;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3HAE LNO;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3DX9 CD;  1OP5 KM;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1Q8M ACD;  1A1M AB;  1AIF HL;  3HAE JMO;  3FCT AB;  3JTT AGH;  3H7B DF;  3EFF AB;  1OM3 HKLM;  3IXA DE;  3HCV AC;  3IVK ABH;  1ZLW HKL;  3HG1 AC;  3EFF DL;  1OM3 HKL;  1OP5 HKLM;  3E3Q PST;  3H9S ACE;  3HG1 ACD;  3FFC AC;  3FQT ABC;  1ZLV HK;  2VSC AB;  3JTT AFG;  3HAE PRS;  3FOL AP;  1OP5 HKL;  3EFF AK;  3FT2 AB;  3DXA ACF;  3GIV ADE;  1ZLU HKLM;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3FB8 AB;  3GIV DE;  1AHW AB;  3HAE AC;  3FOM AP;  3H9S DE;  3DX6 AC;  3DXA DEI;  3FOL ABP;  2VSC BD;  1A1O ABC;  1ZLV HKLM;  3GIV AB;  3FFC IJ;  3GJF DFM;  3GJE BH;  3JTT AD;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  1ZLV HKL;  3GSR ABP;  3GSO AB;  3FRU AD;  1OM3 HK;  3JTT CDF;  1AGF AB;  3GJE ABL;  1ZLV KLM;  3JTT DEF;  1OP5 HK;  3FON ABP;  3EFF CL;  3GJE HL;  3DXA FHJ;  3EFF DK;  3FFC ACI;  3E3Q IJ;  3E3Q VW;  2VSC ABD;  3FQU ABC;  3JTT BDF;  1OM3 KM;  3IVK AB;  3DXA DKM;  3DXA EFH;  3H7B ABC;  3DXA DJ;  3E3Q DE;  3DXA EJ; 

4NZUH 1MJUH 4TRPH 1MEXH 3D9AH 4BUHA 4BUHB 3TV3H 1NCWH 5YD4A 5YD4C 5YD4E 5YD4G 5YD3A 5YD3C 5YD3E 5YD3G 5UD9H 6DDMB 5TY6H 2XZCH 2XKNB 2XKND 6MEEA 6MEEC 6BJZH 5KVGH 5WCAH 4XCFH 5KVFH 1RUPH 1RUKH 5VXRH 5X08H 6NB8H 6A76H 6U1TH 6MEGH 4XAWH 3N9GH 4TULH 5UCBH 2VXVH 6FRJH 4GXVH 4GXVI 2VXTH 6CR1H 1RUMH 2XZAH 2W60A 5W24H 4HPYH 3T65B 5C6WH 5C6WJ 4JG1H 6E65H 3M8OH 5VF2A 5I8CA 4O5LH 5MYXB 5MYXD 3IFLH 5WK2H 3PP4H 3KDMB 3KDMH 5NIVB 5N4JH 2AJUH 2AJVH 5X4GA 3SY0B 4PTUB 4TPRH 4HS6B 4HS6H 3IFNH 5U3PH 6BLAH 4TOYH 4TUOA 4TUOC 3NPSB 5I4FA 1RURH 5ADOH 5WN9H 4XC3H 4M5YH 4M5YI 4TQEH 5YY4A 4ISVB 4XC1H 5VSIH 5ODBA 4CMHB 5JXAH 3QHZH 3QHZI 6QCUH 3UJIH 3NTCH 4YNYA 4YNYC 4TUKH 4YO0A 4YO0C 6AZMB 6AZMD 6BE3H 4NWUH 3HC4H 5VZRA 5VZRH 2W9DH 5EWIH 5E2WH 5MYKB 4NZRH 5MYOB 5MYOD 4HBCH 4AEHH 5UELH 3UZQA 2V17H 4J6RH 5E2VH 5SY8H 5OCKH 5DD1H 5JUEH 5CINH 5A2JH 5JR1H 6CA7H 3CFBB 3CFBH 3WIIH 3WIII 5OB5H 3BKJH 5I66A 4JAMA 4JAMH 6BZYH 3QQ9D 3QQ9H 5TKKH 5FGBC 5FGBE 5W6CH 5I1KH 3OZ9H 4JDVA 4JDVH 5V7UH 5UEAA 5UEAH 4AL8H 3G5YB 5NMVH 4N8CH 4N8CI 5AZ2H 4HGWB 1NLBH 1C5CH 3VFGH 5TDNB 5TDND 3QRGH 4LLYA 4LLYC 4EBQH 5EZIH 4K23H 3NCJH 3UO1H 4M1GH 5W05H 2IPUG 2IPUH 3HC3H 4M61B 4M61D 5YE3B 3BKMH 1UM5H 3QHFH 4NWTH 3WHXA 3NA9H 3BAEH 6RCOA 6RCOC 1NGZB 4LRIC 4LRIP 4ZTPH 4JN2B 4JN2H 4XBEH 1MJ8H 6BE2H 4JFZH 6ARPB 6ARPD 3WIFA 5U6AB 5KVDH 3MBXH 3TWCH 6APCH 4HHAB 6FZQH 5A2KH 4RGOH 5N7BH 5GRYA 5GRYG 5UEKH 3NAAH 1Q0XH 4R90H 4XVTH 5IK3A 5IK3C 5NPHH 5XLIc 5XLId 5IHZA 5IHZC 5IHZE 5IHZH 6DC4H 2R1XB 5U3DB 4WUKH 3MLYH 3MLYI 5U3OH 5JOPE 5JOPH 4HPOH 5UKNH 6BHZH 6BHZI 5IT2H 6MY4A 6MY4H 4POZD 4F57H 5MO3H 5GZ0B 5GZ0D 6DW2B 6BQBH 4PUBH 6B14H 5DD6A 5DD6H 3WIHH 3WIHI 5GS3A 5GS3H 3CFCH 3V4UH 5VKDH 2R1YB 5XHGB 5XHGD 4XMPH 3UYRH 3V0WH 5OCXH 1YQVH 3OAZH 3OAZM 2R2BB 1ZANH 6CJKB 6CJKD 4N0YH 3V52H 6OTCH 5MTHA 5MTHH 3GGWB 3GGWD 1RZFH 5ZMJH 6MY5A 6MY5H 4KTEH 5I8OH 4JG0H 4YGVA 4YGVF 5U4RA 5U4RH 5ALCH 5U5FB 3EO0B 3EO0D 5CILH 6BI2H 6BI2I 5F3BA 5F3BE 4FQIH 6S5AH 4JHAH 6B9ZB 3MCLH 4PTTB 5OD0H 5KVLH 5TDOB 5TDOD 8FABB 8FABD 5NHWH 2ZPKH 2ZPKI 4DGVH 6C5KA 6C5KH 2DQUH 5TH2B 5TH2D 5I8KH 4YDLB 4YDLH 3T4YB 1YNLH 5EPMA 5EPME 2AJSH 3UMTA 3BZ4B 3BZ4D 3BZ4F 3BZ4H 4NUJB 3LIZH 1RUAH 3U2SA 3U2SH 6PE7H 5D6CB 5D6CH 4GAGH 2R23B 4NUGH 3IU4H 3MNZB 6DC8H 3MLRH 1QYGH 6IASH 1P7KB 1P7KH 6OBZA 6OBZH 3RVVD 5A2LH 3P0YH 4NPYB 4NPYH 6ANAH 5IBUG 5IBUH 5VPLD 6AODB 5WCDH 2YPVH 4HH9B 4HH9D 4JY5H 6ELEA 6ELEH 5UR8A 6B5RH 3NACH 5U5MB 2DQTH 1Q72H 4M1DH 4M1DI 6MNQH 1SEQH 4YHOH 6FZRH 6NMTB 2R1WB 3MO1B 4DGYH 5EN2A 3T77B 6P4YH 3MXWH 2V7NB 2V7ND 2V7NF 2V7NH 3EO9H 4ALAH 6N35H 6N35M 4F33B 4F33D 4F33F 4F33H 3C6SB 3C6SD 3C6SF 3C6SH 5WUVH 4Z8FH 3OKLB 4JM4H 2HWZH 5YE4A 5YE4C 6B0GD 5TDPB 5TDPD 1ZEAH 6BAHB 6D0XA 6BE4H 5TPPH 5L88H 1Q9WB 1Q9WD 4P3CH 1L7IH 1JPTH 1AQKH 5TL5H 2FX7H 6O39B 5Y9KH 4DTGH 5CSZA 5CSZH 6GLWC 6GLWH 3WFHA 4K3DH 4K3DI 4H8WH 3HNTH 6GKUH 1WEJH 5VPGD 5HI4C 5HI4H 5NUZA 5NUZH 6QKDH 6QKDI 6QKDJ 6QKDK 5FCUH 3RVWD 5DD3H 5XKUC 3D85B 4Z95H 5HI5C 5HI5H 5JO5A 5JO5C 5JO5E 5JO5H 5L9DH 5CCKH 6GXXH 5I76B 5I76D 1KCVH 1FLRH 6MTTH 5I18H 4JN1H 4P3DA 4P3DH 4G5ZH 6HKGA 6HKGC 3TNMA 3TNMH 2OK0H 3SOBH 6B5MH 5AWNH 4ZFOA 4ZFOH 4G6MH 5DR5H 2IH3A 4KQ3H 6AQ7H 4JFXB 4JFXH 3SGEH 3SGEJ 1BM3H 4TUJA 4TUJC 2VXQH 2XWTA 5FHBH 3HZMB 1JGUH 4I77H 4OCRH 4O4YH 5OBFH 6QNKB 6QNKD 5LGHH 1UZ8B 1UZ8H 1DQQB 1DQQD 5L7XH 5V6MH 5MHEH 5YFIH 4GLRH 4GLRJ 5WK3Q 5WK3S 5WK3U 5WK3W 6MTRH 4HJGB 5OWPH 4M43H 5I30H 3HC0A 3HC0H 3BKCH 6CT7A 6CT7H 3FN0H 5X5XH 4YHIA 4YHIH 5NYXH 5NYXM 5NYXO 5YUPH 4OSUH 3MXVH 5IFAH 1T2QH 6ELJA 6ELJH 4G6KH 4MAUH 3LEXA 3LEXH 6B0WH 6DC7H 6DC7I 5VH4A 5VH4H 6NOUA 5DQDH 5DT1H 4ONFH 1OPGH 1JPSH 5NPJA 5NPJB 1NBYB 3V6OC 3V6OD 3S96A 3S96C 6CBVH 4LKXA 1Q9OB 1Q9OD 3SE8H 5JW5A 5JW5H 5VH3A 5VH3H 6DCVB 6DCVH 5HDQH 4FQ2H 3RKDD 3RKDH 3L1OH 2A77H 2FB4H 3GO1H 1F3DH 1F3DK 3QWOA 3QWOH 3CVIH 1PZ5B 1LK3H 1LK3I 4IOIB 1N7ML 4OKVA 4OKVC 6GHGA 6GHGH 6B5SH 5K8AB 5K8AF 5K8AH 5K8AV 5WKZH 1JGVH 5VAGC 3MLXH 3MLXI 3I9GH 5GIRA 5GIRH 6C5IH 2ADFH 5I16B 5I16H 3O41A 3O41H 5F9OH 3Q6GH 3Q6GI 1UM4H 5VJQA 5VJQC 5VJQE 5VJQG 4RBPH 4RBPM 3I75B 4XVSH 7FABH 4FQLH 1NGXB 1NGXH 1E6OH 5GISH 6H3HA 6H3HC 1JFQH 6B0SH 5FGCE 5GRXG 5GRXH 6DCWH 6DB6H 6A9KB 6A9KH 4H20H 5GGQH 4RFEA 4RFEC 4RFEE 4RFEH 6B5NH 3OAYH 3OAYM 1CR9H 6ANDH 1A3LH 5W0DB 1YEJH 4GMTH 4GMTI 6BPBA 5K9JH 5DS8A 5DS8H 3ZKMC 3ZKMH 1FNSH 5JRPH 3HNSH 1KELH 4DCQB 5TF1H 3TCLA 3TCLH 4OJFH 5F7EH 1N0XH 1N0XK 2FATH 1RULH 1T3FB 6CRKH 4WCYH 5FHAH 4H88H 5UMNC 5UMNE 4X7SH 1UM6H 5DD5H 6C6XA 6C6XC 6C6XE 6C6XH 3H0TB 5A2IH 2AK1H 4X0KA 4X0KH 1S3KH 3HNVH 5E8EB 3LEYH 1YEIH 3QPQD 3QPQF 3QPQH 3QPQJ 6PHBB 6PHBD 5TR8H 3GJFH 3GJFM 5W3PH 3UJJH 6MXRA 6MXRH 6ELLA 6ELLH 2HFFB 2HFFH 4M7KH 1NDGB 3OKDB 2IPTH 1SBSH 1VGEH 6DLAH 6HF1C 6HF1F 6MXSA 6MXSH 4YDKH 4MA3B 4MA3H 5GGSA 5GGSC 2FBJH 1RUQH 2HKFH 4YHYB 4YHYH 5LQBH 4M6NH 1YECH 6FLCB 6FLCH 6DG2A 6DG2C 5I1LB 5I1LH 3UYPA 5GGVH 5D7SH 4TSBH 6FABH 3L5XH 6IEAH 5DUBA 5DUBH 2YMXH 5BJZC 5BJZD 2NXYD 5T29H 2R8SH 5U3NH 4HKZB 6DB8H 3GKZA 1R3JB 5DRNA 5DRNH 1MFBH 6DDRB 1RIUH 3OKKB 5IG7A 5IG7D 5IG7G 5IG7J 5F72S 5F72T 6PHGA 6BFSH 1MFEH 4M6MH 3BPCB 5CHNA 5CHNH 4OCSH 6MEHH 3SO3C 2YK1H 5BVJB 5BVJD 5BVJF 5BVJH 4ODTH 5CGYC 5CGYH 3IDGB 2AJXH 5EOQH 6C5HH 3RU8H 1KN2H 1KN4H 5T4ZA 5T4ZH 1MFCH 1NQBA 1NQBC 5DTFA 5DTFH 3OAUH 5GRUH 5GRUL 2BRRH 2BRRY 5WEQB 3TNNA 3TNNC 3TNNE 3TNNH 5GKRA 5GKRC 5L6YH 3TJEH 6DKJA 6DKJH 3HZVB 4WY7H 5EZJA 4ZYKA 4ZYKH 6DWAB 6DWAH 4UIKH 6C9UH 1NBZB 3LS5H 5MP6H 5MP6P 6BLHH 6E56G 6E56H 4TSCH 5B3NA 3FO9B 3FO9H 5E94B 5E94D 5FB8B 4FZEH 1E4WH 5N7WA 5N7WH 3U0WH 4JO1H 4JO1I 2O5XH 4HIEB 1FL3A 1FL3H 4XNQB 4XNQH 4LEXH 6IDGH 3QEGH 3SE9H 6MEDA 6MEDC 6MEDG 1CE1H 6ME1A 6ME1C 5Y9JH 1Q0YH 3EYSH 5UKPH 3WE6A 12E8H 12E8P 5ITBH 5Y11A 1A3RH 3ZL4H 1HILB 1HILD 2NY2D 5YD5A 5YD5C 1F58H 1QKZH 2G60H 4ODSH 4GQPH 5T5BA 5T5BH 4KMTH 2FR4B 2FR4H 4H0HB 3NZHH 1RHHB 1RHHD 5NPIA 5NPIB 6MQCA 6MQCH 2Q76B 2Q76D 1TJGH 6CW3A 6CW3C 1YEFH 1YEGH 4LLWA 4LLWC 6BTJA 6BTJH 6BLIA 6BLID 6BLIG 6BLIJ 6I9IA 6I9IH 3IFOA 3IFOH 1SM3H 6QN9H 4OT1H 4JPIA 4JPIH 4M7JH 4XTRC 4XTRE 1UYWH 1UYWM 2XQYG 2XQYJ 3O6KH 3C5SB 3C5SD 5DQ9A 5DQ9C 5DQ9H 1RZ7H 1RZGA 1RZGC 5UKQH 1GPOH 1GPOI 2HVKA 5WL2A 5WL2H 5EA0H 1MJJB 1MJJH 5TZUH 3PGFH 5AUMA 5AUMH 2QHRH 1IQDB 6DFJH 5T6LA 5T6LH 1P2CB 1P2CE 2NY4D 4NJ9H 6IGUH 1ORSB 4G6FB 4G6FH 1MLBB 4YHLH 2ZKHH 3OJDB 2NY3D 3ZKNC 3ZKNH 5D70H 1LO0H 1LO0Y 35C8H 6B9YB 1MIEH 4DVBA 4DVBH 2B1HH 3MA9H 5I1AB 5I1AH 1RFDH 1MFDH 6PXGA 6PXGC 6PXGE 6PXGH 2QQNH 3RVTD 6MSYH 3L5WB 3L5WH 2NY1D 6BAEB 6MTPA 6MTPH 4OGYH 4OGYM 3THMH 6PA0A 4YHMH 3EOTH 4MA7H 6CXYH 6H0EA 6H0EC 6H0EE 6H0EH 1LO2H 1LO2Y 1UZ6F 1UZ6H 1UZ6P 1UZ6W 2D03H 5TFWH 3UJTH 3UJTI 5ADPH 3O6LH 3E8UH 1C5BH 3X3FH 4JZNA 4JZNC 4JZNI 2CMRH 5IHUH 5E99H 3GNMH 2FD6H 4S2SA 4S2SH 5ZV3H 4R4BB 4R4BD 4R4BF 4R4BH 1TETH 4BZ2H 5CZXC 5CZXH 2AEPH 5FXCH 4MSWA 5VVFH 5ILTH 6BI0H 6BI0I 4FQHA 4FQHH 5CP3H 5H2BA 6ICCH 3GRWH 5T6PB 5T6PD 4KTDH 6B3KH 5IKCB 5IKCH 3LS4H 1D5IH 4Q2ZA 4Q2ZH 1OSPH 6C6ZC 6C6ZH 5I1DB 5I1DH 1F8TH 5VKKA 5VKKH 6AYZB 6AYZR 4LSPH 5WHJH 2R2HB 1DQJB 1RIVH 3QCUH 3QCUI 1Q9KB 4OTXH 4OTXI 4EOWH 1K4CA 2NXZD 6O3AB 5W5ZH 1E4XH 1E4XI 4QHUB 4QHUH 6E9HA 6CDOA 1UJ3B 3CLFH 5DRXA 5DRXH 4HIXH 5B6FB 5B6FD 5B6FF 5B6FH 4LKCB 1MHHB 1MHHD 4GW5B 4GW5D 1W72H 1W72I 5TJDH 5X2MH 5X2MJ 4OM1H 5D93C 5D93F 4KZDH 4HCRH 4HCRM 6FLBH 4CNIA 4CNIH 1C1EH 5J75A 5J75B 1TJHH 1YEKH 4HIHB 4HIHD 3FFDA 1D6VH 1YY8B 1YY8D 6B3DH 4YHKH 1DZBA 1DZBB 4ONGH 6O1FH 4XH2A 4XH2C 4XH2E 4XH2G 4XH2H 4XH2J 5TE7H 4ETQA 4ETQH 3QPXH 3U4EA 3U4EH 2R0ZH 3DRQB 5CEXB 5CEXD 3NIGE 3NIGH 5IESH 6OCBH 4UV7H 5TKJA 5TKJD 5TKJG 5TKJJ 3UZEA 3UZEB 1TJIH 1KEMH 25C8H 3QNXB 3PHQB 5EOCH 5EOCJ 3G5VB 4OLZH 4GSDH 6AXKA 6R8XC 3UZVB 3D0VB 2C1PB 2C1PH 4O51B 4O51D 4O51F 4O51H 3S34H 5VKHA 6AZXA 6AZXC 1GAFH 6J6YB 6J6YE 2P7TA 6NFUA 5GKSA 5GKSC 3MODH 4HXAH 5E2TH 6B6ZB 6B6ZD 1NDMB 6FFJA 6FFJC 6FFJE 6FFJG 2IQAB 2IQAH 1H0DB 2F5BH 3MNWB 6NMSB 6NMSH 1IL1A 1NC2B 1NC2D 1U8IB 6EMJA 6EMJH 5W1GH 2VDRH 5HI3C 5HI3H 1INDH 6CNRH 2RCSH 5OCAH 1JGLH 4G6JH 2AJ3B 2AJ3D 2AJ3F 6B5TH 6MV5H 5DLMH 5DLMI 1SY6H 3T3PE 3T3PH 4ZTOH 4ZTOI 4RISH 5BVPH 1EMTH 5MESH 5D96C 5D96J 6OKMH 3IDIB 3G6AB 3G6AH 1CLOH 3PNWB 3PNWE 3PNWH 3PNWK 3PNWN 3PNWQ 3PNWT 3PNWW 1FE8H 1FE8I 1FE8J 3QO0B 4NRXA 4NRXD 4NRXH 4AMKH 2Y5TA 1L7TH 5D71H 3O2DH 5MY4B 6JEPH 6JEPK 6DLBH 6DB9H 6NFVA 4GW1B 4GW1D 6DDVB 6B08C 3HI6H 3HI6X 5O14C 5O14H 3IJHB 3IJHD 1XGPB 4ZFGH 6QN7A 6QN7H 5V7RH 3LMJH 6B5OH 2VL5A 2VL5C 1YNKH 6A77H 5XQWH 2YKLH 5T78B 5T78D 1DQDH 1AJ7H 2R0LH 4M93B 4M93H 6BB4H 6BB4I 6BB4J 1DN0B 1DN0D 2PCPB 2PCPD 1AY1H 4ODVH 1MH5B 1MH5H 4MA8H 5VK6A 6E4ZH 4P9MH 5X2NH 5X2NJ 5BK1C 5BK1H 3SGDH 3SGDJ 6N7UA 3HZYB 6MNRH 3GIZH 2HRPH 2HRPN 3QNZB 5NBIH 5Y2KA 5Y2KC 5Y2KE 5Y2KG 1I8MB 1I8MH 5U3LA 5U3LH 6A0ZH 6N32H 6N32K 3NIDE 3NIDH 3Q1SH 1U8HB 6TYBH 6DWCB 6DWCH 3FO2B 3FO2H 5HHVH 1KCUH 2CK0H 1AXTH 4JO4H 4JO4I 1VPOH 5F96H 1NBVH 4IMKA 4IMKB 6PXHC 6PXHH 1OAKH 5VR9A 5VR9H 1XGUB 5VZ1B 5VZ1D 5IFHH 4JZOA 4JZOC 4JZOD 4JZOG 2F5AH 4LSUH 4OLUH 5OD8A 3KR3H 2HKHH 1UB5A 1UB5H 4KVCH 4R97C 4M5ZH 4OLXH 2AJYH 1DQMH 4YUEH 4XNYH 6RCQA 6DZNH 1YEEH 1QBLH 2NY0D 4LSQH 4K3EH 4K3EI 3ZE2E 3ZE2H 1F4XH 4YHZH 6FS0H 6E9KA 4RWYH 4LVOC 4YHNA 4YHNF 5GGUA 5GGUH 3MOAH 5IJVB 5IJVD 5IJVF 5IJVH 3GHBH 3GHBI 2VDOH 3S35H 3HZKB 3QO1B 3OKNB 3GBNH 2PR4H 4D9QE 4D9QH 1A4JB 1A4JH 5KW9H 3QNYB 3QNYD 4LVNC 5MI0B 3VG0H 5ALBH 4ODUA 4ODUH 6EJMH 6EJMI 5JORB 5JORD 5JORF 5JORH 5N2KB 5N2KD 5N2KF 5N2KH 5N2KL 5N2KN 5N2KP 5N2KJ 4PLJD 4PLJH 1BGXH 5UKOH 6EHXB 1YYMH 1YYMR 3ZDXE 3ZDXH 5J13C 6BITI 6BITJ 3DGGB 3DGGD 1MJ7H 6FY2H 6FY2X 2Z4QB 5W2BH 1CT8B 1CT8D 5DRWA 5T1LB 5T1LD 1FL5B 1FL5H 2VDQH 2O5ZH 4OM0H 6ELUB 6ELUE 6ELUH 6ELUK 3H42H 1MREH 6EHWB 5MVZA 5MVZH 5FF6B 5FF6D 3AAZA 3AAZH 6BZWA 6BZWC 6BZWE 6BZWG 4QXGH 3WFDH 1XGQB 6C5JH 3O2VH 6E4XZ 3NIFE 3NIFH 4LSRH 2I5YH 2I5YR 2CGRH 5T1KB 5T1KD 5ID0B 5ID0D 2FX9H 2FX9I 4BZ1H 5AZEH 1MRDH 1GIGH 4WHTA 4WHTC 4WHTE 4WHTG 4WHTI 4WHTK 4WHTM 4WHTO 4WHTQ 4WHTS 4WHTU 4WHTX 5T1MB 5T1MD 3C08H 2NY7H 6AXLA 6AXLD 3U1SH 6D9GA 6D9GC 5ICYB 5ICYD 1BZ7B 4LLUA 4LLUC 1F4WH 5F88B 5F88D 1TZGH 1TZGI 4YX2H 5IR1B 5IR1D 6HIGH 3W9DA 3W9DC 6CBPA 2VXUH 2VXUI 5EORH 6DB7H 6DB7I 1NC4B 1NC4D 1U95B 5IV2B 5IV2D 1IKFH 6CXGH 6CXGM 5HYQB 5HYQD 4LQFH 2DD8H 6CO3H 5YWFB 5YWFD 5DFWH 4NRZA 4NRZH 4NJAH 1NCBH 3C2AH 3C2AI 6QN8A 6QN8C 6QN8E 6QN8G 6QN8H 6QN8J 4NIKB 3BN9D 3BN9F 3MNVB 3MNVD 3GK8H 5NBWB 5NBWH 6EYNB 6EYND 6EYNH 4HWEH 5LX9H 4AEIH 4AEII 4AEIJ 5GS1C 5GS1D 5GS1E 5GS1F 5GS1G 5GS1H 5GS1I 5GS1J 5GS1K 5GS1L 6DZRH 1MRFH 4QF1A 4QF1H 2AI0H 2AI0I 2AI0J 2AI0K 1S5HB 6E4YH 6DF0H 1IQWH 1A0QH 4HQQH 1U8KB 6AZKB 6AZKD 6MQRH 1XF2B 1XF2H 6DF1H 6AZLB 6AZLD 3MCKB 3MCKH 1T66D 1T66H 5TZ2H 6A67C 6A67H 2H1PH 1EAPB 6MLKH 5I2IB 5I2ID 4OCXH 6CDMA 6CDMD 4QTHA 4QTHH 3GHEH 1UWXH 1UWXM 3L95B 3L95H 3V0VA 3V0VH 6AYNB 6AYND 4YAQA 4YAQH 4OGXH 3W9EA 5TFSH 5DYOA 5DYOH 3UTZB 3UTZC 3UTZF 5E2UH 1QBMH 5WHKH 5OPYH 6A0XA 6A0XC 6A0XE 6A0XG 4KZEH 3WKMH 3WKMI 5WT9H 5X2QH 5X2QJ 6NOVA 6NOVC 6IUTH 4HIJB 4HIJD 6MU3H 6MU3M 1LO3H 1LO3Y 3FO1B 3FO1H 4XVUC 4XVUE 4XVUI 4XVUK 5ID1B 5ID1D 5X2PH 5X2PJ 5EBLA 1XGRB 5B71B 5B71D 3ZDYE 3ZDYH 6BF4B 6BF4H 6FBJH 1MRCH 6FG1A 6FG1H 5EUKB 5EUKD 3IETB 3IETD 1XF3B 1XF3H 2BMKB 2BMKH 3QCTH 5VKEA 3EYFB 3EYFD 5OTJB 5OTJH 3NABH 6AZZC 6AZZF 1NJ9B 1NJ9H 5U15A 5U15H 4Q9QH 3IDNB 5IVZB 5IVZD 1XGTB 1IGJB 1IGJD 5IQ9A 5IQ9H 5T85H 2Q8BH 5GHWH 5I1CH 5VZYH 5WNAC 5WNAH 4D9LH 4D9LI 4D9LJ 4D9LK 1RZ8B 1RZ8D 4WV1B 4WV1E 1NGQH 1Q9LB 1Q9LD 6ANPB 6ANPH 5EIIA 5EIIH 4UUJA 5KZPE 5KZPF 5KZPG 5KZPH 4QCIB 4QCIH 5EZLA 5EZLH 4OLYH 4FNLH 4FNLI 1NL0H 4UB0H 2DTMH 1U92B 6AXPB 6AXPD 4KAQH 1CICB 1CICD 1FVDB 1FVDD 6EV2A 6EV2C 6EV2E 6EV2G 1C5DB 1C5DH 1BJ1H 1BJ1K 1NGPH 5IOPB 5IOPD 1U91B 5TIHH 5I1HH 5VPHD 6E9UA 2IQ9H 6IUVC 6IUVH 1F90H 3RVXD 4NZTH 2FX8H 2FX8I 2FX8J 2FX8K 1NGYB 4G6AC 4G6AH 6BFTA 6BFTH 6DFIH 5IFJA 5IFJD 5IFJG 5IFJJ 1M7DB 5I1JH 3IDXH 1U8QB 4FQQB 4FQQD 4FQQF 4FQQH 5ICZB 5ICZD 5CIPH 5CIPA 6IEBE 6IEBH 6ID4C 6ID4H 1EHLH 2VDLH 2G75A 2G75C 6BPDA 3IDJB 3IDMB 1U8JB 6OBDB 6OBDH 6AO0H 5BV7H 5BV7C 5IF0A 5IF0H 4K94H 1K4DA 1IGCH 6BY3A 4L5FH 1RIHH 1MLCB 1MLCD 1FDLH 3V6FA 3V6FC 3V6FE 3V6FH 5K9QG 5K9QH 5K9QJ 5K9QS 5K9QU 5K9QX 6B5LH 2B0SH 2W65A 2W65C 4NKIH 1I7ZB 1I7ZD 6AU5B 6AU5D 5USHD 5USHH 4KI5C 4KI5E 3D0LB 6N6BK 4JPKH 3QG6B 3QG6H 4FQCH 2B2XH 2B2XI 6EHYA 6EHYB 1XF4B 1XF4H 2B1AH 5XAJA 5XAJH 5XAJE 5XAJF 4ZD3H 5VEBA 5VEBH 5ITFB 5ITFD 6N81C 6N81H 5VZXE 5VZXH 2W0FA 2HFEA 4HT1H 6DWIB 6DWID 6DWIF 6DWIH 6DWIJ 6DWIL 6DWIN 6DWIP 2Q8AH 5ETUB 5ETUD 6MQEA 6MQEH 4U0RB 4HKXA 2JK5A 1QOKA 2H8PA 1YEHH 3WFEH 3FCTB 3FCTD 3X3GH 5F6IB 6OL6A 5WAWH 6N16A 6N16C 6N16H 6N16K 2J4WH 15C8H 5EBWA 5W5XH 1KEGH 4TTDC 4TTDH 1NCAH 5E08H 3LRSA 3LRSC 3LRSE 3LRSH 6AZ2A 6AZ2C 2P8LB 4YDJA 4YDJH 1CZ8H 1CZ8Y 3GJEB 3GJEH 5IBTH 3G04B 1RU9H 1CK0H 4X8JA 4X8JH 6CA6B 6CA6H 1UB6A 1UB6H 4DQOH 5DSCA 5DSCC 5DSCE 5DSCH 4XAKD 4XAKH 4HXBH 3WFCH 3R06B 3R06D 3R06F 3R06H 1WC7B 1WC7H 3G5XB 3G5XD 2Z92A 4YR6A 4YR6D 5E8DH 4JO2H 4JO2I 5JQ6H 1A4KB 1A4KH 5ICXB 5ICXD 1CF8H 6DF2B 6DF2H 3T3ME 3T3MH 1KC5H 4I2XB 4I2XD 5OCCH 5MO9H 6BY2A 5LDNH 3HR5B 3HR5H 3HR5I 3HR5J 3GM0A 4K2UH 4K2UI 6OY4D 5XRQA 5XRQH 3O6MH 6JBTH 5EC2A 6AL4B 6AL4D 6AL4F 2I60H 2I60R 5WCCA 5WCCH 1A6TB 1A6TD 4NGHH 5WB9H 2G5BB 2G5BD 2G5BF 2G5BH 4EDWH 6BPAB 6BPAE 2DDQH 4MA1B 4MA1E 4MA1H 1UCBH 5ESQB 5ESQD 1FVEB 1FVED 2NY5H 4NM4H 4NM4I 4LSTH 2VDPH 4WFEE 4WFEG 3U7YH 3JUYA 3JUYB 3JUYC 3JUYD 3JUYE 3JUYF 6OORH 6AVNH 1U8MB 1R3IH 3MACH 4D9RE 4D9RH 4F3FB 3U7WH 4XWGH 4JO3H 4JO3I 6PHHA 6PHHC 2H9GB 2H9GH 4G7VH 6B5PH 2ADGB 4HDIB 4HDIH 2AJZB 2AJZH 5ESAA 1I9JH 5W06H 4HFWB 4HFWH 4O9HH 3L7EB 3L7EH 1Y0LB 1Y0LD 1Y0LF 1Y0LH 5MP5A 5MP5C 5MP5E 5MP5H 6NMUB 6NMUH 6GC2H 2XRAH 5X2OH 5X2OJ 4LIQH 3MLTB 3MLTE 3MLTH 3MLTI 6E9IA 6E9IC 6E9IH 4S1QH 5JO4A 5JO4C 4KQ4H 6EK2H 6EK2I 3INUH 3INUM 3OKOB 1R3LB 5EU7E 5EU7F 5T80H 3DIFB 3DIFD 4NCC2 4NCCH 4LBEA 5OCYH 4PB9H 3LEVH 2VQ1B 2VQ1F 5UBYH 4OLVH 1RJLB 1BQLH 2ORBH 2ORBI 4UINH 6MNSA 6MNSH 1IGIH 1DFBH 6DCAH 6DCAI 6DCAJ 6DCAK 4G3YH 1MAMH 2VDKH 1PLGH 6DSIA 2EH7H 5KG9A 5KG9H 6CDPA 5X8MB 6MTJH 1BFOB 1BFOD 1BFOF 1BFOH 6AMJB 6AMJH 5VGAB 1RZJH 5CEYB 5CEYD 3MUGB 3MUGD 3MUGF 3MUGH 3MUGJ 3MUGL 3OKEB 4HIIB 4HIID 4HK0A 4HK0C 1K6QH 2EH8H 4F58H 4F58I 4F58J 4F58K 1KCSH 1AD0B 1AD0D 4DN3H 4U6VH 4U6VK 4LSSH 4EDXB 4EDXH 1MPAH 3IF1B 3IF1D 5WNBH 5WNBI 2XA8H 4JFYB 4JFYH 4JY6B 4JY6D 3MOBH 3EYVB 3EYVH 2JELH 1GC1H 3STLA 1FORH 5CMAB 1HKLH 4QXUH 3EYUH 3PP3H 3PP3I 1MIMH 2R0WH 5DQJA 5DQJH 4H0IA 5IJKA 5IJKB 3CFDB 3CFDH 1NCCH 1NCDH 3BDYH 5I8EA 5I8EC 5DMGC 5DMGE 5DMGH 5TE6H 5DRZB 5DRZH 1IFHH 2UYLB 2UYLN 2UYLW 2UYLY 3FZUC 3FZUH 1G9MH 1EJOH 4J8RB 4J8RD 3CMOH 3CMOY 5UIXH 3K2UH 4BH8B 4PB0H 3RVUD 1CU4H 1U8NB 3ULSB 3ULSH 6MFTA 6MFTH 4R7DA 4R7DC 4R7DE 4R7DG 4R7DI 4R7DK 4R7DM 4R7DO 4OUUB 4OUUH 4WFFE 4WFFG 5A16A 5A16C 5A16E 5A16G 4HWBH 1CBVH 5HPMB 5HPMD 1AXSB 1AXSH 1LMKA 1LMKC 1LMKE 1LMKG 5YSLA 5YSLC 5YSLE 5YSLG 3OKMB 3MLSH 3MLSI 3MLSJ 3MLSK 1U93B 2GHWB 2GHWD 5V6LH 5V6LI 4O58H 2IH1A 6AL0H 1XF5B 1XF5D 4XNMB 4XNMH 5VSHA 5VSHC 5VSHE 5VSHH 3O2WH 1PG7H 1PG7I 1PG7X 1PG7Z 1FGNH 5U3MH 5TPLH 5UXQA 5UXQH 2HFGH 3CFJB 3CFJD 3CFJF 3CFJH 2MPAH 3GKWH 5JYMB 5JYMD 4Z7QE 4Z7QH 2A1WH 2A1WI 2Y07H 4YHPA 4YHPC 4YHPE 4YHPH 6NMVH 3JWDH 3JWDP 3O0RH 5ZIAA 5ZIAD 5ZIAG 5ZIAH 5ZIAK 5ZIAO 4JQIH 6B0HB 6B0HD 1FAIH 3SKJH 3SKJI 3U30C 3U30F 1INEH 4XZUA 4XZUE 6B0AH 6E63B 6E63H 3QCVH 3QCVI 6F7TB 6F7TH 5EBMA 4ZPTA 4ZPTH 6MFJA 6MFJH 1M7IB 3U0TB 3U0TD 1C12B 5AAMA 5AAMB 4YDVB 4YDVH 6FY0H 6FY0I 5HYSA 5HYSC 5HYSE 5HYSH 1KB5H 5TQAA 5TQAH 3ZDZE 3ZDZH 2VDNH 1MF2H 1MF2N 3FO0H 1TQBB 5MVJA 5MVJC 5MVJE 5MVJH 4YE4H 4LCUA 3L7FB 3L7FE 3L7FH 5I15H 2FJFB 2FJFD 2FJFF 2FJFH 2FJFI 2FJFK 2FJFN 2FJFP 2FJFR 2FJFT 2FJFV 2FJFX 1LO4H 1IGFH 1IGFJ 1WCBB 1WCBH 6CEZH 6BPCB 6BPCE 2XZQH 2VDMH 5I1EH 4RIRA 4RIRH 6BZVA 6BZVC 6BZVE 6BZVG 4ENEC 4ENEE 2BDNH 5GRWA 5GRWB 5JYLB 5JYLD 2F19H 2NYYD 6MTNH 3CLEH 2GCYB 4WHYG 4WHYI 4WHYK 4WHYM 6MU7H 4OCYH 4JLRA 4JLRH 2QQKH 4J1UB 4J1UD 4J1UF 2PW2B 4ZSOB 4ZSOD 1ZTXH 4QNPE 4QNPH 5N4GH 1ETZB 1ETZH 5HBTD 3NGBB 3NGBE 3NGBH 3NGBJ 4RRPG 4RRPH 4RRPI 4RRPJ 4RRPK 4RRPL 3IJSB 3IJSD 5SX5H 5SX5J 5JQDC 5JQDD 1I9IH 2J88H 2GK0B 2GK0H 4H0GA 6JC2H 2F58H 1H3PH 6EWBE 6EWBG 6EWBH 6EWBJ 4S1DC 4S1DE 4S1DH 4S1DO 4XGZA 4XGZC 4XGZE 4XGZG 4XGZH 4XGZJ 4XGZM 4XGZO 4XGZQ 4XGZS 4XGZU 4XGZW 5VLPH 4CADB 4CADE 4CADH 4CADK 1N8ZB 2PW1B 4OAWB 4OAWD 3OR7A 6IDHH 5J74A 5J74B 1TPXB 5UBZH 5SZFH 4XRCB 4XRCH 4KXZH 4KXZJ 4KXZN 4KXZQ 5BK2C 5BK2H 3I02B 3I02D 3BT2H 2R2EB 5UTZB 5UTZF 5UTZH 5UTZJ 1TZHB 1TZHH 5O1RH 5O1RI 5DD0H 6ANIH 6ANII 6CMID 4QWWD 4QWWF 4XMLH 4JZJA 4JZJH 1RMFH 1GGIH 1GGIJ 6H2YH 5BMFH 1MNUH 5BO1H 5BO1I 6D2PH 6FOEA 6FOEH 1JHKH 4M6OH 4IJ3C 5DO2C 5DO2H 3QEHA 3QEHC 3QEHE 3QEHG 4OLWH 4JJ5B 4FQJH 3RPIA 3RPIH 1FRGH 1GGCH 1BBDH 1T4KB 1T4KD 5LSPH 5LSPS 6MWNC 6MWNH 3G5ZB 4DVRH 3EYQD 1CGSH 1V7MH 1V7MI 4OD1H 1ND0B 1ND0D 1ND0F 1ND0H 2Y06H 5MUQA 5MUQH 6PI7C 6PI7F 5H35A 5H35F 5H35H 5BK3A 5BK3C 5BK3E 5BK3H 6HXWC 6HXWH 6MTSH 3WFBH 4R26H 4JY4B 4XWOC 4XWOE 4XWOI 4XWOK 4XWOO 4XWOQ 4XWOU 4XWOW 2VXSH 2VXSI 2VXSJ 2VXSK 2O5YH 2Z91A 2Z91C 3MLVH 3MLVN 3GBMH 3GBMI 4ZFFA 4ZFFH 3HI5H 2AABH 4XXDB 4XXDE 4F37F 4F37H 5F9WB 5F9WH 6BGTB 6H06A 6H06C 6H06E 6H06H 5MU2A 5MU2C 5MU2E 5MU2G 5MU2I 5MU2K 5MU2M 5MU2O 6FY3H 6FY3X 3QG7H 5UKRH 4X80H 3PHOB 3CFKB 3CFKD 3CFKF 3CFKH 3CFKI 3CFKK 3CFKN 3CFKP 3VG9C 2GJZB 2GJZH 4QT5B 4QT5H 5MP3A 5MP3H 4PP2B 4PP2D 1A5FH 1NSNH 2OJZH 2OJZI 2ATKA 1CLYH 5VCOB 5VCOD 4GW4A 4GW4H 4XBGA 4XBGC 4XBGE 4XBGG 4XBGH 4XBGJ 2NLJB 1YYLH 1YYLR 1U8LB 6MTQH 2OZ4H 1IBGH 2NY6D 5FUZH 1EO8H 4KPHH 4KPHI 3DVGB 4I9WE 4I9WG 1KCRH 1GHFH 1DBBH 6QNAA 6QNAC 6QNAE 6QNAH 1CLZH 4OD3H 4HS8H 6MU6H 2AGJH 1N64H 3I2CH 3MLUH 4JKPH 1FN4B 1FN4D 1QFUH 3EYOB 3EYOD 2G2RB 2G2RH 5TQ0H 4TSAH 5BZDB 5BZDD 3Q3GB 3Q3GD 3Q3GH 3Q3GK 5HDBE 5HDBH 3ZE1E 3ZE1H 3NFSH 3B2UC 3B2UF 3B2UH 3B2UJ 3B2UN 3B2UQ 3B2UT 3B2UW 4DN4H 5TRPH 2FGWH 4DGIH 5L0QC 5L0QF 3F58H 1GGBH 1B2WH 6MHRA 6MHRD 2FJGB 2FJGH 1DBJH 1YMHB 1YMHD 4DKFH 4DKFI 5TLKB 5TLKF 5TLKD 5TLKH 6OGXC 6OGXH 1UWEH 1UWEV 1UWEY 1HEZB 1HEZD 4FABH 6MEJA 6MEJH 5YAXA 5YAXB 1IT9H 1DBAH 2DWEA 5LCVH 6DB5H 6DB5I 4Z7NE 4Z7NH 4GAJH 3EFDH 4JR9H 4LF3B 4LF3E 3STZA 2A6IB 6MTOH 6IAPE 6IAPH 6FXND 6FXNF 6FXNH 6FXNM 6FXNO 6FXNQ 3ZE0E 3ZE0H 5K59E 5K59H 1PSKH 5HHXH 6MUBH 6MUBM 3VW3H 3GI9H 1JNHB 1JNHD 1JNHF 1JNHH 3KS0H 3KS0K 6BFQA 6BFQC 6BFQE 6BFQH 5TE4H 3MLWH 3MLWI 1DBMH 5D72H 5D72M 5ANMB 5ANMD 5ANMH 5WI9F 5WI9H 3RA7H 3RA7I 1B4JH 5X0TA 5X0TC 1UWGH 1UWGY 4JPVH 6BKCH 5KN5A 5KN5D 6O3BB 6O3BG 1Q1JH 1Q1JI 1BAFH 4XCNA 4XCNC 4XCNE 4XCNG 4XCNH 4XCNJ 5F3HA 5F3HC 5F3HE 5F3HG 6QIGH 4LEOA 2OP4H 4G7YH 6B3SC 6B3SF 6B3SH 6B3SJ 1BLNB 1BLND 4PY8I 5UEMH 4UIMA 4UIMC 4UIME 4UIMH 3T2NH 3T2NI 3SDYH 5VJOA 5VJOC 3DVNB 3DVNH 3IXTA 3IXTH 6FAXH 2P8MB 4I3RH 4NP4H 4NP4I 2ADIB 1FJ1B 1FJ1D 3UC0H 3UC0I 2ZCHH 1FH5H 1NLDH 4XCEA 4XCEC 4XCEH 4M7ZB 4M7ZH 3IKCB 3IKCD 1BBJB 1BBJH 3BKYH 2JB5H 5WTTA 5WTTH 5I1IH 4NNPH 4NNPX 4ERSH 6CBJH 2OSLA 2OSLH 3O45A 3O45H 1HQ4B 1HQ4D 1DEEB 1DEED 1DEEF 1MCPH 5IIEA 5IIEH 4HC1H 4HC1M 2C1OB 2C1OH 4XP9H 1HIML 1HIMM 5U3KA 5U3KH 4MWFA 4MWFH 3OR6A 5DURB 5DURH 2WUCH 3SQOH 4FFVD 4FFVH 4K3JH 4RGMC 4RGMH 6PE8A 6PE8H 1ZWIA 5F6HI 5F6HK 5F6HM 5F6HO 6N8DD 6N8DF 6IEKB 6IEKE 5W08G 5W08I 5W08K 5W08M 5W08O 5W08Q 2DWDA 2VC2H 6CYFD 6CYFF 6CYFM 6CYFU 1YUHB 1YUHH 1FBIH 1FBIQ 4C83A 4C83C 4PS4H 5GGTH 6OL5A 6OL5H 6PHCA 6PHCC 6MNFH 6MNFM 6BCKH 2A6JB 2A6JH 1F11B 1F11D 1Y18B 1Y18D 1Y18F 1Y18H 1YY9D 2HVJA 4AG4H 3NZ8A 3NZ8H 5HBVD 3HI1B 3HI1H 6FLAA 6FLAH 6EV1A 6EV1C 6EV1E 6EV1G 6EV1I 6EV1K 4PY7A 4PY7I 5WYMA 5WYMC 2BOBA 6M87B 6M87D 6M87F 6M87H 6M87J 6M87L 6AL5H 5KANG 5KANH 5KANJ 4K8RD 4K8RH 3HAEH 3HAEI 3HAEO 3HAET 2Y36H 5JNYA 5JNYC 1RZKH 2DBLH 5WTGB 5WTGD 5TPWH 6A4KH 6A4KI 6A4KJ 6A4KK 5VOBH 5C0NC 5C0NH 6CMGC 4OCWH 6NCPA 6NCPC 6HHCH 1BOGB 5W6GH 1G9NH 6ML8H 4KHTH 3QA3B 3QA3D 3QA3H 3QA3K 2MCPH 6E3HH 4KK8C 4KK8E 1TZIB 3LD8C 5U68E 5U68F 5U68G 1QLRB 1QLRD 6G8RA 4KUZH 1EGJH 1AI1H 2IGFH 4KRPD 2XQBH 3MLZH 1CFQB 4X7TA 4X7TH 1XGYH 1XGYI 4YK4C 4YK4Z 4JPWH 4ODWA 4ODWH 2QSCH 1TQCB 1MHPH 1MHPX 4N9GA 4N9GE 4N9GH 4N9GM 4JB9H 2W9EH 1IAIH 1IAII 3VI3F 3VI3H