3DKWCDI

Crystal structure of dnr from pseudomonas aeruginosa.
Link type Probability Chain C piercings Chain D piercings Chain I piercings
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
view details
Hopf.2 U Ring Hopf.2 U Ring 26% -182I +192I -8C +19C -126C -217I -159D +189D
Interpreting sequences
Chain C Sequence
MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE
Chain C Sequence
MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE
Chain C Sequence
MEFQRVHQQLLQSHHLFEPLSPVQLQELLASSDLVNLDKGAYVFRQGEPAHAFYYLISGCVKIYRLTPEGQEKILEVTNERNTFAEAMMFMDTPNYVATAQAVVPSQLFRFSNKAYLRQLQDNTPLALALLAKLSTRLHQRIDEIETLSLKNATHRVVRYLLTLAAHAPGENCRVEIPVAKQLVAGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLECFE
sequence length 227,227,227
structure length 227,227,227
publication title A dramatic conformational rearrangement is necessary for the activation of DNR from Pseudomonas aeruginosa. Crystal structure of wild-type DNR.
pubmed doi rcsb
molecule tags Transcription regulator
molecule keywords DNR protein
source organism Pseudomonas aeruginosa
pdb deposition date2008-06-26
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
CDI PF00027 cNMP_bindingCyclic nucleotide-binding domain
CDI PF13545 HTH_Crp_2Crp-like helix-turn-helix domain
CDI PF00027 cNMP_bindingCyclic nucleotide-binding domain
CDI PF13545 HTH_Crp_2Crp-like helix-turn-helix domain
CDI PF00027 cNMP_bindingCyclic nucleotide-binding domain
CDI PF13545 HTH_Crp_2Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "winged helix" repressor DNA binding domain 3dkwC02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwC01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "winged helix" repressor DNA binding domain 3dkwD02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwD01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A "winged helix" repressor DNA binding domain 3dkwI02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3dkwI01
1XCBCEG 3DKWEIJ 1XCBACEF 1XCBADEF 3DKWBIJ 3DKWEFH 3DKWCDE 1XCBABEF 3DKWEG 3DKWEHJ 1XCBBCDG 1XCBABDF 3DKWCE 3DKWDI 1XCBABF 1XCBDE 1XCBCDEG 3DKWDGH 3DKWBEH 1XCBCDE 1XCBACFG 1XCBABDE 3DKWABD 1XCBBDEG 1XCBAEFG 1XCBAB 1XCBDF 3DKWAIJ 1XCBAEF 1XCBBE 3EO6AB 1XCBACDG 3DKWBDI 1XCBBEG 1XCBACE 1XCBEF 1XCBCEFG 1XCBBCE 1XCBBCEG 3DKWCIJ 1XCBCEF 3DKWCDJ 3DKWBD 1XCBADEG 3DKWBI 3DKWFIJ 3DKWGHJ 1XCBABCG 3DKWBCD 3DKWFGH 3DKWCEH 3DKWCDI 3DKWAGH 3DKWBC 1XCBABEG 3DKWEH 3DKWGH 3DKWGHI 3DKWCEF 1XCBCE 3DKWDIJ 3DKWFH 1XCBAF 1XCBDEF 1XCBCDF 3DKWEHI 3DKWCH 1XCBBCDE 3DKWHIJ 3DKWABC 3DKWABG 1XCBBDEF 1XCBAFG 1XCBAE 1XCBABFG 3DKWDEF 3DKWABJ 1XCBBEFG 1XCBACDE 3DKWEFJ 3DKWDEH 3DKWEFG 1XCBACG 3DKWABI 3DKWCDG 3DKWCEI 1XCBADFG 3DKWCGH 3DKWCDH 3DKWCFI 1XCBACEG 3DKWEGH 3DKWEFI 3DKWAEF 3ES4AB 1XCBABCE 3DKWAB 1XCBCDFG 1XCBCD 1XCBABG 3DKWEF 1XCBCDG 3DKWCI 1XCBBDE 3DKWCD 2DI3AB 3DKWABF 1XCBCG 3DKWIJ 1XCBABE 1XCBCDEF 1XCBBG 3DKWBGH 3DKWCJ 3DKWBEF 1XCBADE 3DKWACD 3DKWAEH 1XCBBCG 3DKWABE 3DKWCHI 1XCBAEG 1XCBAG 1XCBACDF 3DKWBDH 1XCBBEF 3DKWHI 1XCBADF 3DKWACI 3DKWABH 3DKWCDF 1XCBBCEF
chains in the LinkProt database with same CATH superfamily
2GSYFJNP 2GSYHIL 1XCBCEG 2GSYKNOP 2GSYJKQS 2GSYHLR 3DKWFIJ 2GSYEKP 1XCBACEF 1XCBADEF 2GSYJOP 2GSYMNRT 3DKWBIJ 2GSYCHLN 3DKWEFH 2GSYGHM 2GSYABQ 2GSYINS 2GSYFHIK 2GSYGR 2GSYFGLN 2GSYEFHN 3DKWCDE 2GSYGHMT 2GSYFGIR 2GSYDJOP 2GSYEIKO 1XCBABEF 3DKWEG 3DKWEIJ 3DKWEHJ 2GSYGIPQ 2GSYABD 1XCBBCDG 1XCBABDF 2GSYGIL 2GSYCEKO 3DKWCE 2GSYFGIL 2GSYFHIL 2GSYGKLN 1F2NABC 2GSYCDLO 2GSYCEOQ 2GSYHIS 3DKWDI 1XCBABF 1XCBDE 1XCBCDEG 3DKWDGH 2GSYHLMT 2GSYCIOP 2GSYGIS 3DKWBEH 2GSYCHLR 1XCBCDE 1XCBACFG 2GSYEKOQ 2GSYFLNP 1XCBABDE 2GSYGI 2GSYEOP 2GSYCKOS 3DKWABD 2GSYEIKQ 1XCBBDEG 1XCBAEFG 2GSYHLMN 1XCBAB 1XCBDF 3DKWAIJ 1XCBAEF 2GSYFJP 1XCBBE 2GSYFKPS 2GSYDJP 2GSYGHIL 3EO6AB 1XCBACDG 3DKWBDI 2GSYAJOQ 1XCBBEG 2GSYFLNS 2GSYABE 1XCBACE 1XCBEF 1XCBCEFG 2GSYDJKO 2GSYFHIR 1XCBBCE 2GSYCDLN 1XCBBCEG 2GSYGIST 3DKWCIJ 1XCBCEF 2GSYKNOS 3DKWCDJ 3DKWBD 2GSYLN 2GSYEKQ 2GSYGHN 1XCBADEG 3DKWBI 1AU7AB 2GSYGHIK 2GSYGIR 3DKWGHJ 2GSYFJKO 2GSYINR 2GSYFKOQ 1XCBABCG 3DKWBCD 2GSYMRST 2GSYFKNP 3DKWFGH 2GSYEKPQ 2GSYEIKP 3DKWCEH 2GSYHIM 2GSYHIN 3DKWCDI 3DKWAGH 3DKWBC 1XCBABEG 3DKWEH 3DKWGH 2GSYKOQ 2GSYFIK 2GSYCHLM 3DKWGHI 2GSYGHMN 2GSYFHIM 2GSYGIP 1F2NAC 3DKWCEF 2GSYGMRT 1XCBCE 3DKWDIJ 2GSYGHIM 3DKWFH 2GSYKOP 1XCBAF 2GSYFGIP 2GSYFNST 2GSYMR 2GSYCJKO 2GSYIMST 2GSYCGHL 1XCBDEF 2GSYEJPQ 1XCBCDF 2GSYINRS 3DKWEHI 2GSYKOQS 3DKWCH 1XCBBCDE 2GSYEOQ 3DKWHIJ 3DKWABC 2GSYFHNP 2GSYFHIN 2GSYGHR 3DKWABG 2GSYKPQ 1XCBBDEF 2GSYEHIP 1XCBAFG 1XCBAE 2GSYGLR 2GSYHLMR 2GSYEFST 2GSYEKOS 2GSYEFHI 2GSYFLNR 2GSYDJQ 1XCBABFG 3DKWDEF 2GSYFHNS 2GSYFHIS 3DKWABJ 2GSYHLN 2GSYKQST 2GSYGLMR 2GSYCKOP 2GSYCJOQ 2GSYKNOR 2GSYKOST 2GSYABOQ 2GSYCJOP 2GSYDEJP 2GSYFNS 2GSYAEFK 1XCBBEFG 2GSYCLOP 1XCBACDE 3DKWEFJ 3B9IAB 3DKWDEH 3DKWEFG 2GSYEJKP 1XCBACG 2GSYGHIP 2GSYIKQS 2GSYFKNQ 2GSYFNR 3DKWABI 3DKWCDG 3DKWCEI 2GSYEFLN 1XCBADFG 3DKWCGH 3DKWCDH 2GSYEFQS 2GSYAIPQ 3DKWCFI 2GSYFP 1XCBACEG 2GSYFGIK 3DKWEGH 2GSYABPQ 2GSYFJKQ 3DKWEFI 2GSYGN 2GSYKPST 3DKWAEF 3ES4AB 1XCBABCE 3DKWAB 1XCBCDFG 2GSYFKST 1XCBCD 2GSYGHL 2GSYEKPS 2GSYKNST 2GSYFGIS 2GSYHIP 2GSYGIN 2GSYDJOQ 1F2NBC 1XCBABG 2GSYKPS 2GSYFS 3DKWEF 1XCBCDG 2GSYKOS 2GSYCJKQ 3DKWCI 2GSYGHI 2GSYCHLO 2GSYGIK 1XCBBDE 2GSYAKQ 3DKWCD 2GSYDFJP 2GSYAEFO 2DI3AB 3DKWABF 1F2NAB 2GSYCEOP 1XCBCG 3DKWIJ 1XCBABE 1XCBCDEF 2GSYCILN 2GSYFI 1XCBBG 2GSYHIK 3DKWBGH 2GSYGHIN 2GSYGLN 2GSYFNP 1QEXAB 2GSYST 2GSYEKOP 3DKWCJ 3DKWBEF 2GSYCDGL 1XCBADE 2GSYGH 3DKWACD 2GSYHKLN 3DKWAEH 2GSYFHNR 2GSYFHIP 1XCBBCG 3DKWABE 2GSYGHMR 2GSYFIKS 2GSYCKOQ 2GSYFKPQ 3DKWCHI 2GSYDEJQ 1XCBAEG 2QDNAB 2GSYHLM 2GSYFGIN 1XCBAG 1XCBACDF 2GSYFJKP 3DKWBDH 2GSYGHIR 1XCBBEF 3DKWHI 2GSYINP 1XCBADF 2GSYFIP 2GSYGHIS 3DKWACI 2GSYIJNP 2GSYHIR 2GSYACEO 2GSYGIPS 3DKWABH 2GSYDEJO 3DKWCDF 1XCBBCEF
chains in the LinkProt database with same CATH topology
2GSYFJNP 2GSYHIL 1XCBCEG 2GSYKNOP 2GSYJKQS 2GSYHLR 3DKWEIJ 2GSYEKP 1XCBACEF 1XCBADEF 2GSYJOP 2GSYMNRT 3DKWBIJ 2GSYCHLN 3DKWEFH 2GSYGHM 2GSYABQ 2GSYINS 2GSYFHIK 2GSYGR 2GSYFGLN 2GSYEFHN 3DKWCDE 2GSYGHMT 2GSYFGIR 2GSYDJOP 2GSYEIKO 1XCBABEF 3DKWEG 3DKWEHJ 2GSYGIPQ 2GSYABD 1XCBBCDG 1XCBABDF 2GSYGIL 2GSYCEKO 3DKWCE 2GSYFGIL 2GSYFHIL 2GSYGKLN 1F2NABC 2GSYCDLO 2GSYCEOQ 2GSYHIS 3DKWDI 1XCBABF 1XCBDE 1XCBCDEG 3DKWDGH 2GSYHLMT 2GSYCIOP 2GSYGIS 3DKWBEH 2GSYCHLR 1XCBCDE 1XCBACFG 2GSYEKOQ 2GSYFLNP 1XCBABDE 2GSYGI 2GSYEOP 2GSYCKOS 3DKWABD 2GSYEIKQ 1XCBBDEG 1XCBAEFG 2GSYHLMN 1XCBAB 1XCBDF 3DKWAIJ 1XCBAEF 2GSYFJP 1XCBBE 2GSYFKPS 2GSYDJP 2GSYGHIL 3EO6AB 1XCBACDG 3DKWBDI 2GSYAJOQ 1XCBBEG 2GSYFLNS 2GSYABE 1XCBACE 1XCBEF 1XCBCEFG 2GSYDJKO 2GSYFHIR 1XCBBCE 2GSYCDLN 1XCBBCEG 2GSYGIST 3DKWCIJ 1XCBCEF 2GSYKNOS 3DKWCDJ 3DKWBD 2GSYLN 2GSYEKQ 2GSYGHN 1XCBADEG 3DKWBI 3DKWFIJ 2GSYGHIK 2GSYGIR 3DKWGHJ 2GSYFJKO 2GSYINR 2GSYFKOQ 1XCBABCG 3DKWBCD 2GSYMRST 2GSYFKNP 3DKWFGH 2GSYEKPQ 2GSYEIKP 3DKWCEH 2GSYHIM 2GSYHIN 3DKWCDI 3DKWAGH 3DKWBC 1XCBABEG 3DKWEH 3DKWGH 2GSYKOQ 2GSYFIK 2GSYCHLM 3DKWGHI 2GSYGHMN 2GSYFHIM 2GSYGIP 1F2NAC 3DKWCEF 2GSYGMRT 1XCBCE 3DKWDIJ 2GSYGHIM 3DKWFH 2GSYKOP 1XCBAF 2GSYFGIP 2GSYFNST 2GSYMR 2GSYCJKO 2GSYIMST 2GSYCGHL 1XCBDEF 2GSYEJPQ 1XCBCDF 2GSYINRS 3DKWEHI 2GSYKOQS 3DKWCH 1XCBBCDE 2GSYEOQ 3DKWHIJ 3DKWABC 2GSYFHNP 2GSYFHIN 2GSYGHR 3DKWABG 2GSYKPQ 1XCBBDEF 2GSYEHIP 1XCBAFG 1XCBAE 2GSYGLR 2GSYHLMR 2GSYEFST 2GSYEKOS 2GSYEFHI 2GSYFLNR 2GSYDJQ 1XCBABFG 3DKWDEF 2GSYFHNS 2GSYFHIS 3DKWABJ 2GSYHLN 2GSYKQST 2GSYGLMR 2GSYCKOP 2GSYCJOQ 2GSYKNOR 2GSYKOST 2GSYABOQ 2GSYCJOP 2GSYDEJP 2GSYFNS 2GSYAEFK 1XCBBEFG 2GSYCLOP 1XCBACDE 3DKWEFJ 3B9IAB 3DKWDEH 3DKWEFG 2GSYEJKP 1XCBACG 2GSYGHIP 2GSYIKQS 2GSYFKNQ 2GSYFNR 3DKWABI 3DKWCDG 3DKWCEI 2GSYEFLN 1XCBADFG 3DKWCGH 3DKWCDH 2GSYEFQS 2GSYAIPQ 3DKWCFI 2GSYFP 1XCBACEG 2GSYFGIK 3DKWEGH 2GSYABPQ 2GSYFJKQ 3DKWEFI 2GSYGN 2GSYKPST 3DKWAEF 3ES4AB 1XCBABCE 3DKWAB 1XCBCDFG 2GSYFKST 1XCBCD 2GSYGHL 2GSYEKPS 2GSYKNST 2GSYFGIS 2GSYHIP 2GSYGIN 2GSYDJOQ 1F2NBC 1XCBABG 2GSYKPS 2GSYFS 3DKWEF 1XCBCDG 2GSYKOS 2GSYCJKQ 3DKWCI 2GSYGHI 2GSYCHLO 2GSYGIK 1XCBBDE 2GSYAKQ 3DKWCD 2GSYDFJP 2GSYAEFO 2DI3AB 3DKWABF 1F2NAB 2GSYCEOP 1XCBCG 3DKWIJ 1XCBABE 1XCBCDEF 2GSYCILN 2GSYFI 1XCBBG 2GSYHIK 3DKWBGH 2GSYGHIN 2GSYGLN 2GSYFNP 2GSYST 2GSYEKOP 3DKWCJ 3DKWBEF 2GSYCDGL 1XCBADE 2GSYGH 3DKWACD 2GSYHKLN 3DKWAEH 2GSYFHNR 2GSYFHIP 1XCBBCG 3DKWABE 2GSYGHMR 2GSYFIKS 2GSYCKOQ 2GSYFKPQ 3DKWCHI 2GSYDEJQ 1XCBAEG 2QDNAB 2GSYHLM 2GSYFGIN 1XCBAG 1XCBACDF 2GSYFJKP 3DKWBDH 2GSYGHIR 1XCBBEF 3DKWHI 2GSYINP 1XCBADF 2GSYFIP 2GSYGHIS 3DKWACI 2GSYIJNP 2GSYHIR 2GSYACEO 2GSYGIPS 3DKWABH 2GSYDEJO 3DKWCDF 1XCBBCEF
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 1XCB CEG;  3DKW EIJ;  1XCB ACEF;  1XCB ADEF;  3DKW BIJ;  3DKW EFH;  3DKW CDE;  1XCB ABEF;  3DKW EG;  3DKW EHJ;  1XCB BCDG;  1XCB ABDF;  3DKW CE;  3DKW DI;  1XCB ABF;  1XCB DE;  1XCB CDEG;  3DKW DGH;  3DKW BEH;  1XCB CDE;  1XCB ACFG;  1XCB ABDE;  3DKW ABD;  1XCB BDEG;  1XCB AEFG;  1XCB AB;  1XCB DF;  3DKW AIJ;  1XCB AEF;  1XCB BE;  3EO6 AB;  1XCB ACDG;  3DKW BDI;  1XCB BEG;  1XCB ACE;  1XCB EF;  1XCB CEFG;  1XCB BCE;  1XCB BCEG;  3DKW CIJ;  1XCB CEF;  3DKW CDJ;  3DKW BD;  1XCB ADEG;  3DKW BI;  3DKW FIJ;  3DKW GHJ;  1XCB ABCG;  3DKW BCD;  3DKW FGH;  3DKW CEH;  3DKW CDI;  3DKW AGH;  3DKW BC;  1XCB ABEG;  3DKW EH;  3DKW GH;  3DKW GHI;  3DKW CEF;  1XCB CE;  3DKW DIJ;  3DKW FH;  1XCB AF;  1XCB DEF;  1XCB CDF;  3DKW EHI;  3DKW CH;  1XCB BCDE;  3DKW HIJ;  3DKW ABC;  3DKW ABG;  1XCB BDEF;  1XCB AFG;  1XCB AE;  1XCB ABFG;  3DKW DEF;  3DKW ABJ;  1XCB BEFG;  1XCB ACDE;  3DKW EFJ;  3DKW DEH;  3DKW EFG;  1XCB ACG;  3DKW ABI;  3DKW CDG;  3DKW CEI;  1XCB ADFG;  3DKW CGH;  3DKW CDH;  3DKW CFI;  1XCB ACEG;  3DKW EGH;  3DKW EFI;  3DKW AEF;  3ES4 AB;  1XCB ABCE;  3DKW AB;  1XCB CDFG;  1XCB CD;  1XCB ABG;  3DKW EF;  1XCB CDG;  3DKW CI;  1XCB BDE;  3DKW CD;  2DI3 AB;  3DKW ABF;  1XCB CG;  3DKW IJ;  1XCB ABE;  1XCB CDEF;  1XCB BG;  3DKW BGH;  3DKW CJ;  3DKW BEF;  1XCB ADE;  3DKW ACD;  3DKW AEH;  1XCB BCG;  3DKW ABE;  3DKW CHI;  1XCB AEG;  1XCB AG;  1XCB ACDF;  3DKW BDH;  1XCB BEF;  3DKW HI;  1XCB ADF;  3DKW ACI;  3DKW ABH;  3DKW CDF;  1XCB BCEF; 
#chains in the LinkProt database with same CATH topology
 2GSY FJNP;  2GSY HIL;  1XCB CEG;  2GSY KNOP;  2GSY JKQS;  2GSY HLR;  3DKW FIJ;  2GSY EKP;  1XCB ACEF;  1XCB ADEF;  2GSY JOP;  2GSY MNRT;  3DKW BIJ;  2GSY CHLN;  3DKW EFH;  2GSY GHM;  2GSY ABQ;  2GSY INS;  2GSY FHIK;  2GSY GR;  2GSY FGLN;  2GSY EFHN;  3DKW CDE;  2GSY GHMT;  2GSY FGIR;  2GSY DJOP;  2GSY EIKO;  1XCB ABEF;  3DKW EG;  3DKW EIJ;  3DKW EHJ;  2GSY GIPQ;  2GSY ABD;  1XCB BCDG;  1XCB ABDF;  2GSY GIL;  2GSY CEKO;  3DKW CE;  2GSY FGIL;  2GSY FHIL;  2GSY GKLN;  1F2N ABC;  2GSY CDLO;  2GSY CEOQ;  2GSY HIS;  3DKW DI;  1XCB ABF;  1XCB DE;  1XCB CDEG;  3DKW DGH;  2GSY HLMT;  2GSY CIOP;  2GSY GIS;  3DKW BEH;  2GSY CHLR;  1XCB CDE;  1XCB ACFG;  2GSY EKOQ;  2GSY FLNP;  1XCB ABDE;  2GSY GI;  2GSY EOP;  2GSY CKOS;  3DKW ABD;  2GSY EIKQ;  1XCB BDEG;  1XCB AEFG;  2GSY HLMN;  1XCB AB;  1XCB DF;  3DKW AIJ;  1XCB AEF;  2GSY FJP;  1XCB BE;  2GSY FKPS;  2GSY DJP;  2GSY GHIL;  3EO6 AB;  1XCB ACDG;  3DKW BDI;  2GSY AJOQ;  1XCB BEG;  2GSY FLNS;  2GSY ABE;  1XCB ACE;  1XCB EF;  1XCB CEFG;  2GSY DJKO;  2GSY FHIR;  1XCB BCE;  2GSY CDLN;  1XCB BCEG;  2GSY GIST;  3DKW CIJ;  1XCB CEF;  2GSY KNOS;  3DKW CDJ;  3DKW BD;  2GSY LN;  2GSY EKQ;  2GSY GHN;  1XCB ADEG;  3DKW BI;  1AU7 AB;  2GSY GHIK;  2GSY GIR;  3DKW GHJ;  2GSY FJKO;  2GSY INR;  2GSY FKOQ;  1XCB ABCG;  3DKW BCD;  2GSY MRST;  2GSY FKNP;  3DKW FGH;  2GSY EKPQ;  2GSY EIKP;  3DKW CEH;  2GSY HIM;  2GSY HIN;  3DKW CDI;  3DKW AGH;  3DKW BC;  1XCB ABEG;  3DKW EH;  3DKW GH;  2GSY KOQ;  2GSY FIK;  2GSY CHLM;  3DKW GHI;  2GSY GHMN;  2GSY FHIM;  2GSY GIP;  1F2N AC;  3DKW CEF;  2GSY GMRT;  1XCB CE;  3DKW DIJ;  2GSY GHIM;  3DKW FH;  2GSY KOP;  1XCB AF;  2GSY FGIP;  2GSY FNST;  2GSY MR;  2GSY CJKO;  2GSY IMST;  2GSY CGHL;  1XCB DEF;  2GSY EJPQ;  1XCB CDF;  2GSY INRS;  3DKW EHI;  2GSY KOQS;  3DKW CH;  1XCB BCDE;  2GSY EOQ;  3DKW HIJ;  3DKW ABC;  2GSY FHNP;  2GSY FHIN;  2GSY GHR;  3DKW ABG;  2GSY KPQ;  1XCB BDEF;  2GSY EHIP;  1XCB AFG;  1XCB AE;  2GSY GLR;  2GSY HLMR;  2GSY EFST;  2GSY EKOS;  2GSY EFHI;  2GSY FLNR;  2GSY DJQ;  1XCB ABFG;  3DKW DEF;  2GSY FHNS;  2GSY FHIS;  3DKW ABJ;  2GSY HLN;  2GSY KQST;  2GSY GLMR;  2GSY CKOP;  2GSY CJOQ;  2GSY KNOR;  2GSY KOST;  2GSY ABOQ;  2GSY CJOP;  2GSY DEJP;  2GSY FNS;  2GSY AEFK;  1XCB BEFG;  2GSY CLOP;  1XCB ACDE;  3DKW EFJ;  3B9I AB;  3DKW DEH;  3DKW EFG;  2GSY EJKP;  1XCB ACG;  2GSY GHIP;  2GSY IKQS;  2GSY FKNQ;  2GSY FNR;  3DKW ABI;  3DKW CDG;  3DKW CEI;  2GSY EFLN;  1XCB ADFG;  3DKW CGH;  3DKW CDH;  2GSY EFQS;  2GSY AIPQ;  3DKW CFI;  2GSY FP;  1XCB ACEG;  2GSY FGIK;  3DKW EGH;  2GSY ABPQ;  2GSY FJKQ;  3DKW EFI;  2GSY GN;  2GSY KPST;  3DKW AEF;  3ES4 AB;  1XCB ABCE;  3DKW AB;  1XCB CDFG;  2GSY FKST;  1XCB CD;  2GSY GHL;  2GSY EKPS;  2GSY KNST;  2GSY FGIS;  2GSY HIP;  2GSY GIN;  2GSY DJOQ;  1F2N BC;  1XCB ABG;  2GSY KPS;  2GSY FS;  3DKW EF;  1XCB CDG;  2GSY KOS;  2GSY CJKQ;  3DKW CI;  2GSY GHI;  2GSY CHLO;  2GSY GIK;  1XCB BDE;  2GSY AKQ;  3DKW CD;  2GSY DFJP;  2GSY AEFO;  2DI3 AB;  3DKW ABF;  1F2N AB;  2GSY CEOP;  1XCB CG;  3DKW IJ;  1XCB ABE;  1XCB CDEF;  2GSY CILN;  2GSY FI;  1XCB BG;  2GSY HIK;  3DKW BGH;  2GSY GHIN;  2GSY GLN;  2GSY FNP;  1QEX AB;  2GSY ST;  2GSY EKOP;  3DKW CJ;  3DKW BEF;  2GSY CDGL;  1XCB ADE;  2GSY GH;  3DKW ACD;  2GSY HKLN;  3DKW AEH;  2GSY FHNR;  2GSY FHIP;  1XCB BCG;  3DKW ABE;  2GSY GHMR;  2GSY FIKS;  2GSY CKOQ;  2GSY FKPQ;  3DKW CHI;  2GSY DEJQ;  1XCB AEG;  2QDN AB;  2GSY HLM;  2GSY FGIN;  1XCB AG;  1XCB ACDF;  2GSY FJKP;  3DKW BDH;  2GSY GHIR;  1XCB BEF;  3DKW HI;  2GSY INP;  1XCB ADF;  2GSY FIP;  2GSY GHIS;  3DKW ACI;  2GSY IJNP;  2GSY HIR;  2GSY ACEO;  2GSY GIPS;  3DKW ABH;  2GSY DEJO;  3DKW CDF;  1XCB BCEF; 
#chains in the LinkProt database with same CATH homology
 2GSY FJNP;  2GSY HIL;  1XCB CEG;  2GSY KNOP;  2GSY JKQS;  2GSY HLR;  3DKW EIJ;  2GSY EKP;  1XCB ACEF;  1XCB ADEF;  2GSY JOP;  2GSY MNRT;  3DKW BIJ;  2GSY CHLN;  3DKW EFH;  2GSY GHM;  2GSY ABQ;  2GSY INS;  2GSY FHIK;  2GSY GR;  2GSY FGLN;  2GSY EFHN;  3DKW CDE;  2GSY GHMT;  2GSY FGIR;  2GSY DJOP;  2GSY EIKO;  1XCB ABEF;  3DKW EG;  3DKW EHJ;  2GSY GIPQ;  2GSY ABD;  1XCB BCDG;  1XCB ABDF;  2GSY GIL;  2GSY CEKO;  3DKW CE;  2GSY FGIL;  2GSY FHIL;  2GSY GKLN;  1F2N ABC;  2GSY CDLO;  2GSY CEOQ;  2GSY HIS;  3DKW DI;  1XCB ABF;  1XCB DE;  1XCB CDEG;  3DKW DGH;  2GSY HLMT;  2GSY CIOP;  2GSY GIS;  3DKW BEH;  2GSY CHLR;  1XCB CDE;  1XCB ACFG;  2GSY EKOQ;  2GSY FLNP;  1XCB ABDE;  2GSY GI;  2GSY EOP;  2GSY CKOS;  3DKW ABD;  2GSY EIKQ;  1XCB BDEG;  1XCB AEFG;  2GSY HLMN;  1XCB AB;  1XCB DF;  3DKW AIJ;  1XCB AEF;  2GSY FJP;  1XCB BE;  2GSY FKPS;  2GSY DJP;  2GSY GHIL;  3EO6 AB;  1XCB ACDG;  3DKW BDI;  2GSY AJOQ;  1XCB BEG;  2GSY FLNS;  2GSY ABE;  1XCB ACE;  1XCB EF;  1XCB CEFG;  2GSY DJKO;  2GSY FHIR;  1XCB BCE;  2GSY CDLN;  1XCB BCEG;  2GSY GIST;  3DKW CIJ;  1XCB CEF;  2GSY KNOS;  3DKW CDJ;  3DKW BD;  2GSY LN;  2GSY EKQ;  2GSY GHN;  1XCB ADEG;  3DKW BI;  3DKW FIJ;  2GSY GHIK;  2GSY GIR;  3DKW GHJ;  2GSY FJKO;  2GSY INR;  2GSY FKOQ;  1XCB ABCG;  3DKW BCD;  2GSY MRST;  2GSY FKNP;  3DKW FGH;  2GSY EKPQ;  2GSY EIKP;  3DKW CEH;  2GSY HIM;  2GSY HIN;  3DKW CDI;  3DKW AGH;  3DKW BC;  1XCB ABEG;  3DKW EH;  3DKW GH;  2GSY KOQ;  2GSY FIK;  2GSY CHLM;  3DKW GHI;  2GSY GHMN;  2GSY FHIM;  2GSY GIP;  1F2N AC;  3DKW CEF;  2GSY GMRT;  1XCB CE;  3DKW DIJ;  2GSY GHIM;  3DKW FH;  2GSY KOP;  1XCB AF;  2GSY FGIP;  2GSY FNST;  2GSY MR;  2GSY CJKO;  2GSY IMST;  2GSY CGHL;  1XCB DEF;  2GSY EJPQ;  1XCB CDF;  2GSY INRS;  3DKW EHI;  2GSY KOQS;  3DKW CH;  1XCB BCDE;  2GSY EOQ;  3DKW HIJ;  3DKW ABC;  2GSY FHNP;  2GSY FHIN;  2GSY GHR;  3DKW ABG;  2GSY KPQ;  1XCB BDEF;  2GSY EHIP;  1XCB AFG;  1XCB AE;  2GSY GLR;  2GSY HLMR;  2GSY EFST;  2GSY EKOS;  2GSY EFHI;  2GSY FLNR;  2GSY DJQ;  1XCB ABFG;  3DKW DEF;  2GSY FHNS;  2GSY FHIS;  3DKW ABJ;  2GSY HLN;  2GSY KQST;  2GSY GLMR;  2GSY CKOP;  2GSY CJOQ;  2GSY KNOR;  2GSY KOST;  2GSY ABOQ;  2GSY CJOP;  2GSY DEJP;  2GSY FNS;  2GSY AEFK;  1XCB BEFG;  2GSY CLOP;  1XCB ACDE;  3DKW EFJ;  3B9I AB;  3DKW DEH;  3DKW EFG;  2GSY EJKP;  1XCB ACG;  2GSY GHIP;  2GSY IKQS;  2GSY FKNQ;  2GSY FNR;  3DKW ABI;  3DKW CDG;  3DKW CEI;  2GSY EFLN;  1XCB ADFG;  3DKW CGH;  3DKW CDH;  2GSY EFQS;  2GSY AIPQ;  3DKW CFI;  2GSY FP;  1XCB ACEG;  2GSY FGIK;  3DKW EGH;  2GSY ABPQ;  2GSY FJKQ;  3DKW EFI;  2GSY GN;  2GSY KPST;  3DKW AEF;  3ES4 AB;  1XCB ABCE;  3DKW AB;  1XCB CDFG;  2GSY FKST;  1XCB CD;  2GSY GHL;  2GSY EKPS;  2GSY KNST;  2GSY FGIS;  2GSY HIP;  2GSY GIN;  2GSY DJOQ;  1F2N BC;  1XCB ABG;  2GSY KPS;  2GSY FS;  3DKW EF;  1XCB CDG;  2GSY KOS;  2GSY CJKQ;  3DKW CI;  2GSY GHI;  2GSY CHLO;  2GSY GIK;  1XCB BDE;  2GSY AKQ;  3DKW CD;  2GSY DFJP;  2GSY AEFO;  2DI3 AB;  3DKW ABF;  1F2N AB;  2GSY CEOP;  1XCB CG;  3DKW IJ;  1XCB ABE;  1XCB CDEF;  2GSY CILN;  2GSY FI;  1XCB BG;  2GSY HIK;  3DKW BGH;  2GSY GHIN;  2GSY GLN;  2GSY FNP;  2GSY ST;  2GSY EKOP;  3DKW CJ;  3DKW BEF;  2GSY CDGL;  1XCB ADE;  2GSY GH;  3DKW ACD;  2GSY HKLN;  3DKW AEH;  2GSY FHNR;  2GSY FHIP;  1XCB BCG;  3DKW ABE;  2GSY GHMR;  2GSY FIKS;  2GSY CKOQ;  2GSY FKPQ;  3DKW CHI;  2GSY DEJQ;  1XCB AEG;  2QDN AB;  2GSY HLM;  2GSY FGIN;  1XCB AG;  1XCB ACDF;  2GSY FJKP;  3DKW BDH;  2GSY GHIR;  1XCB BEF;  3DKW HI;  2GSY INP;  1XCB ADF;  2GSY FIP;  2GSY GHIS;  3DKW ACI;  2GSY IJNP;  2GSY HIR;  2GSY ACEO;  2GSY GIPS;  3DKW ABH;  2GSY DEJO;  3DKW CDF;  1XCB BCEF; 

3DKWA 3DKWB 3DKWD 3DKWE 3DKWF 3DKWG 3DKWH 3DKWI 3DKWJ 3DKWA 3DKWB 3DKWC 3DKWE 3DKWF 3DKWG 3DKWH 3DKWI 3DKWJ 3DKWA 3DKWB 3DKWC 3DKWD 3DKWE 3DKWF 3DKWG 3DKWH 3DKWJ
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3DKW_A;  3DKW_B;  3DKW_D;  3DKW_E;  3DKW_F;  3DKW_G;  3DKW_H;  3DKW_I;  3DKW_J;  3DKW_A;  3DKW_B;  3DKW_C;  3DKW_E;  3DKW_F;  3DKW_G;  3DKW_H;  3DKW_I;  3DKW_J;  3DKW_A;  3DKW_B;  3DKW_C;  3DKW_D;  3DKW_E;  3DKW_F;  3DKW_G;  3DKW_H;  3DKW_J; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling