1FYRABCD

Dimer formation through domain swapping in the crystal structure of the grb2-sh2 ac-pyvnv complex
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
view details
Other Other 35% -134B -153B -150C -152C +67A -82A +86A +150B
Interpreting sequences
Chain A Sequence
HPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Chain A Sequence
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Chain A Sequence
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Chain A Sequence
HPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
sequence length 95,98,98,95
structure length 95,98,98,95
publication title Dimer formation through domain swapping in the crystal structure of the Grb2-SH2-Ac-pYVNV complex.
pubmed doi rcsb
molecule tags Hormone/growth factor
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
source organism Homo sapiens
pdb deposition date2000-10-03
LinkProt deposition date2016-08-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABCD PF00017 SH2SH2 domain
ABCD PF00018 SH3_1SH3 domain
ABCD PF00017 SH2SH2 domain
ABCD PF00018 SH3_1SH3 domain
ABCD PF00017 SH2SH2 domain
ABCD PF00018 SH3_1SH3 domain
ABCD PF00017 SH2SH2 domain
ABCD PF00018 SH3_1SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SHC Adaptor Protein 1fyrA00
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SHC Adaptor Protein 1fyrB00
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SHC Adaptor Protein 1fyrC00
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SHC Adaptor Protein 1fyrD00
1FYRBDL 1FYRABC 1A81CIJ 1FYRBIK 1FYRBK 2AOAAB 1A81CD 1FYRDKL 1FYRBJK 2H5KAB 1FYRACD 2QMSACD 2AOBBC 1FYRBCDJ 1FYRBDK 2H5KABC 1A81CI 1FYRACDJ 1FYRABCK 1FYRABK 1FYRDIJK 1FYRDJL 2H5KBC 1A81EK 1FYRABD 1FYRACJ 2QMSABD 1FYRAIL 1FYRCD 1FYRACJK 2QMSCD 1FYRADIJ 1FYRAKL 1FYRBCDI 1FYRACKL 1FYRBJL 1A81CJ 1FYRCDJK 1FYRCDIK 1FYRAI 1FYRABCJ 1FYRABIJ 1FYRBIJK 1FYRACJL 1FYRBDIJ 1FYRDK 1FYRADI 1FYRACIK 1FYRABCD 1FYRCDL 1FYRCIL 1FYRBCKL 1A81KL 1FYRAL 1FYRBCD 1FYRDJKL 1FYRBIL 1FYRADJL 1FYRCJ 1FYRADIL 1FYRBL 1FYRCDI 1FYRAC 1FYRBCL 1FYRDJ 1FYRACIL 1A81AH 1FYRBDIL 1FYRBDJ 2H5KAC 1FYRCIJK 1FYRBC 2AOBCD 1FYRBI 1FYRBCIL 1FYRBDJL 1FYRACDK 1FYRDL 1FYRAIJL 1FYRACI 2AOBACD 1FYRADL 1FYRBCI 1FYRADKL 1FYRCJKL 1FYRABDJ 1FYRABKL 1FYRBDI 1FYRCIJL 2AOBABCD 1A81EF 1FYRABI 1FYRDIJ 1FYRACL 1FYRDIKL 1FYRABIK 1FYRABDI 1FYRACIJ 1A81AB 1FYRCJK 1FYRBDJK 1FYRBCJL 1FYRBCIJ 1FYRAJK 1FYRAIJK 1FYRCIK 1FYRBJKL 2AOBAD 1FYRCDKL 1FYRABIL 1FYRCI 1FYRABJK 1A81GH 1FYRAIK 1FYRABDL 1A81AG 1FYRACDL 1FYRCKL 1FYRCJL 1FYRBKL 1FYRCDJ 1FYRDJK 2AOBAC 1FYRAB 2QMSAB 2AOBABD 1FYRBIJL 1FYRCL 1FYRAJL 1FYRBCDL 1A81AGH 1FYRBDKL 1FYRBIJ 1FYRBJ 1FYRAIKL 1FYRAJ 1FYRAJKL 1FYRCDIL 1FYRDIL 1FYRADK 1FYRBCJ 1FYRABJL 1FYRBCDK 1FYRDI 1FYRADIK 1FYRACDI 1FYRABJ 1FYRDIJL 1FYRACK 1FYRAD 1FYRADJK 2QMSAD 2AOBABC 1FYRBIKL 1FYRBCK 1FYRBCJK 1FYRBCIK 2AOBBCD 1FYRCIJ 1FYRBD 1FYRAK 1FYRCDJL 1FYRCDIJ 1FYRDIK 1FYRABCI 1FYRAIJ 1FYRADJ 1FYRBDIK 2AOBBD 1FYRCIKL 1FYRABDK 1FYRCDK 1FYRABCL 2AOBAB 1FYRABL 2QMSABCD 1FYRCK
chains in the LinkProt database with same CATH superfamily
1FYRBDL 1FYRABC 1A81CIJ 1FYRBIK 1FYRBK 2AOAAB 1A81CD 1FYRDKL 1FYRBJK 2H5KAB 1FYRACD 2QMSACD 2AOBBC 1FYRBCDJ 1FYRBDK 2H5KABC 1A81CI 1FYRACDJ 1FYRABCK 1FYRABK 1FYRDIJK 1FYRDJL 2H5KBC 1A81EK 1FYRABD 1FYRACJ 2QMSABD 1FYRAIL 1FYRCD 1FYRACJK 2QMSCD 1FYRADIJ 1FYRAKL 1FYRBCDI 1FYRACKL 1FYRBJL 1A81CJ 1FYRCDJK 1FYRCDIK 1FYRAI 1FYRABCJ 1FYRABIJ 1FYRBIJK 1FYRACJL 1FYRBDIJ 1FYRDK 1FYRADI 1FYRACIK 1FYRABCD 1FYRCDL 1FYRCIL 1FYRBCKL 1A81KL 1FYRAL 1FYRBCD 1FYRDJKL 1FYRBIL 1FYRADJL 1FYRCJ 1FYRADIL 1FYRBL 1FYRCDI 1FYRAC 1FYRBCL 1FYRDJ 1FYRACIL 1A81AH 1FYRBDIL 1FYRBDJ 2H5KAC 1FYRCIJK 1FYRBC 2AOBCD 1FYRBI 1FYRBCIL 1FYRBDJL 1FYRACDK 1FYRDL 1FYRAIJL 1FYRACI 2AOBACD 1FYRADL 1FYRBCI 1FYRADKL 1FYRCJKL 1FYRABDJ 1FYRABKL 1FYRBDI 1FYRCIJL 2AOBABCD 1A81EF 1FYRABI 1FYRDIJ 1FYRACL 1FYRDIKL 1FYRABIK 1FYRABDI 1FYRACIJ 1A81AB 1FYRCJK 1FYRBDJK 1FYRBCJL 1FYRBCIJ 1FYRAJK 1FYRAIJK 1FYRCIK 1FYRBJKL 2AOBAD 1FYRCDKL 1FYRABIL 1FYRCI 1FYRABJK 1A81GH 1FYRAIK 1FYRABDL 1A81AG 1FYRACDL 1FYRCKL 1FYRCJL 1FYRBKL 1FYRCDJ 1FYRDJK 2AOBAC 1FYRAB 2QMSAB 2AOBABD 1FYRBIJL 1FYRCL 1FYRAJL 1FYRBCDL 1A81AGH 1FYRBDKL 1FYRBIJ 1FYRBJ 1FYRAIKL 1FYRAJ 1FYRAJKL 1FYRCDIL 1FYRDIL 1FYRADK 1FYRBCJ 1FYRABJL 1FYRBCDK 1FYRDI 1FYRADIK 1FYRACDI 1FYRABJ 1FYRDIJL 1FYRACK 1FYRAD 1FYRADJK 2QMSAD 2AOBABC 1FYRBIKL 1FYRBCK 1FYRBCJK 1FYRBCIK 2AOBBCD 1FYRCIJ 1FYRBD 1FYRAK 1FYRCDJL 1FYRCDIJ 1FYRDIK 1FYRABCI 1FYRAIJ 1FYRADJ 1FYRBDIK 2AOBBD 1FYRCIKL 1FYRABDK 1FYRCDK 1FYRABCL 2AOBAB 1FYRABL 2QMSABCD 1FYRCK
chains in the LinkProt database with same CATH topology
1FYRBDL 1FYRABC 1A81CIJ 1FYRBIK 1FYRBK 2AOAAB 1A81CD 1FYRDKL 1FYRBJK 2H5KAB 1FYRACD 2QMSACD 2AOBBC 1FYRBCDJ 1FYRBDK 2H5KABC 1A81CI 1FYRACDJ 1FYRABCK 1FYRABK 1FYRDIJK 1FYRDJL 2H5KBC 1A81EK 1FYRABD 1FYRACJ 2QMSABD 1FYRAIL 1FYRCD 1FYRACJK 2QMSCD 1FYRADIJ 1FYRAKL 1FYRBCDI 1FYRACKL 1FYRBJL 1A81CJ 1FYRCDJK 1FYRCDIK 1FYRAI 1FYRABCJ 1FYRABIJ 1FYRBIJK 1FYRACJL 1FYRBDIJ 1FYRDK 1FYRADI 1FYRACIK 1FYRABCD 1FYRCDL 1FYRCIL 1FYRBCKL 1A81KL 1FYRAL 1FYRBCD 1FYRDJKL 1FYRBIL 1FYRADJL 1FYRCJ 1FYRADIL 1FYRBL 1FYRCDI 1FYRAC 1FYRBCL 1FYRDJ 1FYRACIL 1A81AH 1FYRBDIL 1FYRBDJ 2H5KAC 1FYRCIJK 1FYRBC 2AOBCD 1FYRBI 1FYRBCIL 1FYRBDJL 1FYRACDK 1FYRDL 1FYRAIJL 1FYRACI 2AOBACD 1FYRADL 1FYRBCI 1FYRADKL 1FYRCJKL 1FYRABDJ 1FYRABKL 1FYRBDI 1FYRCIJL 2AOBABCD 1A81EF 1FYRABI 1FYRDIJ 1FYRACL 1FYRDIKL 1FYRABIK 1FYRABDI 1FYRACIJ 1A81AB 1FYRCJK 1FYRBDJK 1FYRBCJL 1FYRBCIJ 1FYRAJK 1FYRAIJK 1FYRCIK 1FYRBJKL 2AOBAD 1FYRCDKL 1FYRABIL 1FYRCI 1FYRABJK 1A81GH 1FYRAIK 1FYRABDL 1A81AG 1FYRACDL 1FYRCKL 1FYRCJL 1FYRBKL 1FYRCDJ 1FYRDJK 2AOBAC 1FYRAB 2QMSAB 2AOBABD 1FYRBIJL 1FYRCL 1FYRAJL 1FYRBCDL 1A81AGH 1FYRBDKL 1FYRBIJ 1FYRBJ 1FYRAIKL 1FYRAJ 1FYRAJKL 1FYRCDIL 1FYRDIL 1FYRADK 1FYRBCJ 1FYRABJL 1FYRBCDK 1FYRDI 1FYRADIK 1FYRACDI 1FYRABJ 1FYRDIJL 1FYRACK 1FYRAD 1FYRADJK 2QMSAD 2AOBABC 1FYRBIKL 1FYRBCK 1FYRBCJK 1FYRBCIK 2AOBBCD 1FYRCIJ 1FYRBD 1FYRAK 1FYRCDJL 1FYRCDIJ 1FYRDIK 1FYRABCI 1FYRAIJ 1FYRADJ 1FYRBDIK 2AOBBD 1FYRCIKL 1FYRABDK 1FYRCDK 1FYRABCL 2AOBAB 1FYRABL 2QMSABCD 1FYRCK
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 1FYR BDL;  1FYR ABC;  1A81 CIJ;  1FYR BIK;  1FYR BK;  2AOA AB;  1A81 CD;  1FYR DKL;  1FYR BJK;  2H5K AB;  1FYR ACD;  2QMS ACD;  2AOB BC;  1FYR BCDJ;  1FYR BDK;  2H5K ABC;  1A81 CI;  1FYR ACDJ;  1FYR ABCK;  1FYR ABK;  1FYR DIJK;  1FYR DJL;  2H5K BC;  1A81 EK;  1FYR ABD;  1FYR ACJ;  2QMS ABD;  1FYR AIL;  1FYR CD;  1FYR ACJK;  2QMS CD;  1FYR ADIJ;  1FYR AKL;  1FYR BCDI;  1FYR ACKL;  1FYR BJL;  1A81 CJ;  1FYR CDJK;  1FYR CDIK;  1FYR AI;  1FYR ABCJ;  1FYR ABIJ;  1FYR BIJK;  1FYR ACJL;  1FYR BDIJ;  1FYR DK;  1FYR ADI;  1FYR ACIK;  1FYR ABCD;  1FYR CDL;  1FYR CIL;  1FYR BCKL;  1A81 KL;  1FYR AL;  1FYR BCD;  1FYR DJKL;  1FYR BIL;  1FYR ADJL;  1FYR CJ;  1FYR ADIL;  1FYR BL;  1FYR CDI;  1FYR AC;  1FYR BCL;  1FYR DJ;  1FYR ACIL;  1A81 AH;  1FYR BDIL;  1FYR BDJ;  2H5K AC;  1FYR CIJK;  1FYR BC;  2AOB CD;  1FYR BI;  1FYR BCIL;  1FYR BDJL;  1FYR ACDK;  1FYR DL;  1FYR AIJL;  1FYR ACI;  2AOB ACD;  1FYR ADL;  1FYR BCI;  1FYR ADKL;  1FYR CJKL;  1FYR ABDJ;  1FYR ABKL;  1FYR BDI;  1FYR CIJL;  2AOB ABCD;  1A81 EF;  1FYR ABI;  1FYR DIJ;  1FYR ACL;  1FYR DIKL;  1FYR ABIK;  1FYR ABDI;  1FYR ACIJ;  1A81 AB;  1FYR CJK;  1FYR BDJK;  1FYR BCJL;  1FYR BCIJ;  1FYR AJK;  1FYR AIJK;  1FYR CIK;  1FYR BJKL;  2AOB AD;  1FYR CDKL;  1FYR ABIL;  1FYR CI;  1FYR ABJK;  1A81 GH;  1FYR AIK;  1FYR ABDL;  1A81 AG;  1FYR ACDL;  1FYR CKL;  1FYR CJL;  1FYR BKL;  1FYR CDJ;  1FYR DJK;  2AOB AC;  1FYR AB;  2QMS AB;  2AOB ABD;  1FYR BIJL;  1FYR CL;  1FYR AJL;  1FYR BCDL;  1A81 AGH;  1FYR BDKL;  1FYR BIJ;  1FYR BJ;  1FYR AIKL;  1FYR AJ;  1FYR AJKL;  1FYR CDIL;  1FYR DIL;  1FYR ADK;  1FYR BCJ;  1FYR ABJL;  1FYR BCDK;  1FYR DI;  1FYR ADIK;  1FYR ACDI;  1FYR ABJ;  1FYR DIJL;  1FYR ACK;  1FYR AD;  1FYR ADJK;  2QMS AD;  2AOB ABC;  1FYR BIKL;  1FYR BCK;  1FYR BCJK;  1FYR BCIK;  2AOB BCD;  1FYR CIJ;  1FYR BD;  1FYR AK;  1FYR CDJL;  1FYR CDIJ;  1FYR DIK;  1FYR ABCI;  1FYR AIJ;  1FYR ADJ;  1FYR BDIK;  2AOB BD;  1FYR CIKL;  1FYR ABDK;  1FYR CDK;  1FYR ABCL;  2AOB AB;  1FYR ABL;  2QMS ABCD;  1FYR CK; 
#chains in the LinkProt database with same CATH topology
 1FYR BDL;  1FYR ABC;  1A81 CIJ;  1FYR BIK;  1FYR BK;  2AOA AB;  1A81 CD;  1FYR DKL;  1FYR BJK;  2H5K AB;  1FYR ACD;  2QMS ACD;  2AOB BC;  1FYR BCDJ;  1FYR BDK;  2H5K ABC;  1A81 CI;  1FYR ACDJ;  1FYR ABCK;  1FYR ABK;  1FYR DIJK;  1FYR DJL;  2H5K BC;  1A81 EK;  1FYR ABD;  1FYR ACJ;  2QMS ABD;  1FYR AIL;  1FYR CD;  1FYR ACJK;  2QMS CD;  1FYR ADIJ;  1FYR AKL;  1FYR BCDI;  1FYR ACKL;  1FYR BJL;  1A81 CJ;  1FYR CDJK;  1FYR CDIK;  1FYR AI;  1FYR ABCJ;  1FYR ABIJ;  1FYR BIJK;  1FYR ACJL;  1FYR BDIJ;  1FYR DK;  1FYR ADI;  1FYR ACIK;  1FYR ABCD;  1FYR CDL;  1FYR CIL;  1FYR BCKL;  1A81 KL;  1FYR AL;  1FYR BCD;  1FYR DJKL;  1FYR BIL;  1FYR ADJL;  1FYR CJ;  1FYR ADIL;  1FYR BL;  1FYR CDI;  1FYR AC;  1FYR BCL;  1FYR DJ;  1FYR ACIL;  1A81 AH;  1FYR BDIL;  1FYR BDJ;  2H5K AC;  1FYR CIJK;  1FYR BC;  2AOB CD;  1FYR BI;  1FYR BCIL;  1FYR BDJL;  1FYR ACDK;  1FYR DL;  1FYR AIJL;  1FYR ACI;  2AOB ACD;  1FYR ADL;  1FYR BCI;  1FYR ADKL;  1FYR CJKL;  1FYR ABDJ;  1FYR ABKL;  1FYR BDI;  1FYR CIJL;  2AOB ABCD;  1A81 EF;  1FYR ABI;  1FYR DIJ;  1FYR ACL;  1FYR DIKL;  1FYR ABIK;  1FYR ABDI;  1FYR ACIJ;  1A81 AB;  1FYR CJK;  1FYR BDJK;  1FYR BCJL;  1FYR BCIJ;  1FYR AJK;  1FYR AIJK;  1FYR CIK;  1FYR BJKL;  2AOB AD;  1FYR CDKL;  1FYR ABIL;  1FYR CI;  1FYR ABJK;  1A81 GH;  1FYR AIK;  1FYR ABDL;  1A81 AG;  1FYR ACDL;  1FYR CKL;  1FYR CJL;  1FYR BKL;  1FYR CDJ;  1FYR DJK;  2AOB AC;  1FYR AB;  2QMS AB;  2AOB ABD;  1FYR BIJL;  1FYR CL;  1FYR AJL;  1FYR BCDL;  1A81 AGH;  1FYR BDKL;  1FYR BIJ;  1FYR BJ;  1FYR AIKL;  1FYR AJ;  1FYR AJKL;  1FYR CDIL;  1FYR DIL;  1FYR ADK;  1FYR BCJ;  1FYR ABJL;  1FYR BCDK;  1FYR DI;  1FYR ADIK;  1FYR ACDI;  1FYR ABJ;  1FYR DIJL;  1FYR ACK;  1FYR AD;  1FYR ADJK;  2QMS AD;  2AOB ABC;  1FYR BIKL;  1FYR BCK;  1FYR BCJK;  1FYR BCIK;  2AOB BCD;  1FYR CIJ;  1FYR BD;  1FYR AK;  1FYR CDJL;  1FYR CDIJ;  1FYR DIK;  1FYR ABCI;  1FYR AIJ;  1FYR ADJ;  1FYR BDIK;  2AOB BD;  1FYR CIKL;  1FYR ABDK;  1FYR CDK;  1FYR ABCL;  2AOB AB;  1FYR ABL;  2QMS ABCD;  1FYR CK; 
#chains in the LinkProt database with same CATH homology
 1FYR BDL;  1FYR ABC;  1A81 CIJ;  1FYR BIK;  1FYR BK;  2AOA AB;  1A81 CD;  1FYR DKL;  1FYR BJK;  2H5K AB;  1FYR ACD;  2QMS ACD;  2AOB BC;  1FYR BCDJ;  1FYR BDK;  2H5K ABC;  1A81 CI;  1FYR ACDJ;  1FYR ABCK;  1FYR ABK;  1FYR DIJK;  1FYR DJL;  2H5K BC;  1A81 EK;  1FYR ABD;  1FYR ACJ;  2QMS ABD;  1FYR AIL;  1FYR CD;  1FYR ACJK;  2QMS CD;  1FYR ADIJ;  1FYR AKL;  1FYR BCDI;  1FYR ACKL;  1FYR BJL;  1A81 CJ;  1FYR CDJK;  1FYR CDIK;  1FYR AI;  1FYR ABCJ;  1FYR ABIJ;  1FYR BIJK;  1FYR ACJL;  1FYR BDIJ;  1FYR DK;  1FYR ADI;  1FYR ACIK;  1FYR ABCD;  1FYR CDL;  1FYR CIL;  1FYR BCKL;  1A81 KL;  1FYR AL;  1FYR BCD;  1FYR DJKL;  1FYR BIL;  1FYR ADJL;  1FYR CJ;  1FYR ADIL;  1FYR BL;  1FYR CDI;  1FYR AC;  1FYR BCL;  1FYR DJ;  1FYR ACIL;  1A81 AH;  1FYR BDIL;  1FYR BDJ;  2H5K AC;  1FYR CIJK;  1FYR BC;  2AOB CD;  1FYR BI;  1FYR BCIL;  1FYR BDJL;  1FYR ACDK;  1FYR DL;  1FYR AIJL;  1FYR ACI;  2AOB ACD;  1FYR ADL;  1FYR BCI;  1FYR ADKL;  1FYR CJKL;  1FYR ABDJ;  1FYR ABKL;  1FYR BDI;  1FYR CIJL;  2AOB ABCD;  1A81 EF;  1FYR ABI;  1FYR DIJ;  1FYR ACL;  1FYR DIKL;  1FYR ABIK;  1FYR ABDI;  1FYR ACIJ;  1A81 AB;  1FYR CJK;  1FYR BDJK;  1FYR BCJL;  1FYR BCIJ;  1FYR AJK;  1FYR AIJK;  1FYR CIK;  1FYR BJKL;  2AOB AD;  1FYR CDKL;  1FYR ABIL;  1FYR CI;  1FYR ABJK;  1A81 GH;  1FYR AIK;  1FYR ABDL;  1A81 AG;  1FYR ACDL;  1FYR CKL;  1FYR CJL;  1FYR BKL;  1FYR CDJ;  1FYR DJK;  2AOB AC;  1FYR AB;  2QMS AB;  2AOB ABD;  1FYR BIJL;  1FYR CL;  1FYR AJL;  1FYR BCDL;  1A81 AGH;  1FYR BDKL;  1FYR BIJ;  1FYR BJ;  1FYR AIKL;  1FYR AJ;  1FYR AJKL;  1FYR CDIL;  1FYR DIL;  1FYR ADK;  1FYR BCJ;  1FYR ABJL;  1FYR BCDK;  1FYR DI;  1FYR ADIK;  1FYR ACDI;  1FYR ABJ;  1FYR DIJL;  1FYR ACK;  1FYR AD;  1FYR ADJK;  2QMS AD;  2AOB ABC;  1FYR BIKL;  1FYR BCK;  1FYR BCJK;  1FYR BCIK;  2AOB BCD;  1FYR CIJ;  1FYR BD;  1FYR AK;  1FYR CDJL;  1FYR CDIJ;  1FYR DIK;  1FYR ABCI;  1FYR AIJ;  1FYR ADJ;  1FYR BDIK;  2AOB BD;  1FYR CIKL;  1FYR ABDK;  1FYR CDK;  1FYR ABCL;  2AOB AB;  1FYR ABL;  2QMS ABCD;  1FYR CK; 

6ICGA 6ICGB 5GJHA 5GJHC 3WA4A 3OV1A 1JYRA 4P9VA 3IN8A 3S8NA 3S8OA 3S8LA 3C7IA 1ZFPE 1R1QA 1R1QB 4P9ZA 1BMBA 3OVEA 1R1PA 1R1PB 1R1PC 1R1PD 2AOBA 2AOBB 2AOBC 2AOBD 3N84A 3N84B 3N84C 3N84D 3N84E 3N84F 3N7YA 3N7YB 3N7YC 1JYQA 1JYQB 3N8MA 1R1SA 1R1SC 1R1SE 1R1SG 2H46E 3IMDA 3IMDB 2HUWA 2HUWB 3KFJA 3IMJA 3IMJB 3MXCA 6ICHA 1BM2A 1TZEE 3IN7A 3IN7C 2AOAA 2AOAB 3MXYA 1FYRB 1FYRC 1FYRD 5CDWA 5CDWB 5CDWC 5CDWE 5CDWG 5CDWH 5CDWK 5CDWL 5CDWO 5CDWP 5CDWU 5CDWV 5CDWY 5CDWZ 5CDWc 5CDWd 1JYUA 2H5KA 2H5KB 1CJ1A 1CJ1B 1CJ1C 1CJ1D 1CJ1E 1CJ1F 1CJ1G 1CJ1H 1CJ1I 1CJ1J 1CJ1K 1CJ1L 1X0NA 1QG1E 1FHSA 1GHUA 6ICGA 6ICGB 5GJHA 5GJHC 3WA4A 3OV1A 1JYRA 4P9VA 3IN8A 3S8NA 3S8OA 3S8LA 3C7IA 1ZFPE 1R1QA 1R1QB 4P9ZA 1BMBA 3OVEA 1R1PA 1R1PB 1R1PC 1R1PD 2AOBA 2AOBB 2AOBC 2AOBD 3N84A 3N84B 3N84C 3N84D 3N84E 3N84F 3N7YA 3N7YB 3N7YC 1JYQA 1JYQB 3N8MA 1R1SA 1R1SC 1R1SE 1R1SG 2H46E 3IMDA 3IMDB 2HUWA 2HUWB 3KFJA 3IMJA 3IMJB 3MXCA 6ICHA 1BM2A 1TZEE 3IN7A 3IN7C 2AOAA 2AOAB 3MXYA 1FYRA 1FYRC 1FYRD 5CDWA 5CDWB 5CDWC 5CDWE 5CDWG 5CDWH 5CDWK 5CDWL 5CDWO 5CDWP 5CDWU 5CDWV 5CDWY 5CDWZ 5CDWc 5CDWd 1JYUA 2H5KA 2H5KB 1CJ1A 1CJ1B 1CJ1C 1CJ1D 1CJ1E 1CJ1F 1CJ1G 1CJ1H 1CJ1I 1CJ1J 1CJ1K 1CJ1L 1X0NA 1QG1E 1FHSA 1GHUA 6ICGA 6ICGB 5GJHA 5GJHC 3WA4A 3OV1A 1JYRA 4P9VA 3IN8A 3S8NA 3S8OA 3S8LA 3C7IA 1ZFPE 1R1QA 1R1QB 4P9ZA 1BMBA 3OVEA 1R1PA 1R1PB 1R1PC 1R1PD 2AOBA 2AOBB 2AOBC 2AOBD 3N84A 3N84B 3N84C 3N84D 3N84E 3N84F 3N7YA 3N7YB 3N7YC 1JYQA 1JYQB 3N8MA 1R1SA 1R1SC 1R1SE 1R1SG 2H46E 3IMDA 3IMDB 2HUWA 2HUWB 3KFJA 3IMJA 3IMJB 3MXCA 6ICHA 1BM2A 1TZEE 3IN7A 3IN7C 2AOAA 2AOAB 3MXYA 1FYRA 1FYRB 1FYRD 5CDWA 5CDWB 5CDWC 5CDWE 5CDWG 5CDWH 5CDWK 5CDWL 5CDWO 5CDWP 5CDWU 5CDWV 5CDWY 5CDWZ 5CDWc 5CDWd 1JYUA 2H5KA 2H5KB 1CJ1A 1CJ1B 1CJ1C 1CJ1D 1CJ1E 1CJ1F 1CJ1G 1CJ1H 1CJ1I 1CJ1J 1CJ1K 1CJ1L 1X0NA 1QG1E 1FHSA 1GHUA 6ICGA 6ICGB 5GJHA 5GJHC 3WA4A 3OV1A 1JYRA 4P9VA 3IN8A 3S8NA 3S8OA 3S8LA 3C7IA 1ZFPE 1R1QA 1R1QB 4P9ZA 1BMBA 3OVEA 1R1PA 1R1PB 1R1PC 1R1PD 2AOBA 2AOBB 2AOBC 2AOBD 3N84A 3N84B 3N84C 3N84D 3N84E 3N84F 3N7YA 3N7YB 3N7YC 1JYQA 1JYQB 3N8MA 1R1SA 1R1SC 1R1SE 1R1SG 2H46E 3IMDA 3IMDB 2HUWA 2HUWB 3KFJA 3IMJA 3IMJB 3MXCA 6ICHA 1BM2A 1TZEE 3IN7A 3IN7C 2AOAA 2AOAB 3MXYA 1FYRA 1FYRB 1FYRC 5CDWA 5CDWB 5CDWC 5CDWE 5CDWG 5CDWH 5CDWK 5CDWL 5CDWO 5CDWP 5CDWU 5CDWV 5CDWY 5CDWZ 5CDWc 5CDWd 1JYUA 2H5KA 2H5KB 1CJ1A 1CJ1B 1CJ1C 1CJ1D 1CJ1E 1CJ1F 1CJ1G 1CJ1H 1CJ1I 1CJ1J 1CJ1K 1CJ1L 1X0NA 1QG1E 1FHSA 1GHUA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6ICG_A;  6ICG_B;  5GJH_A;  5GJH_C;  3WA4_A;  3OV1_A;  1JYR_A;  4P9V_A;  3IN8_A;  3S8N_A;  3S8O_A;  3S8L_A;  3C7I_A;  1ZFP_E;  1R1Q_A;  1R1Q_B;  4P9Z_A;  1BMB_A;  3OVE_A;  1R1P_A;  1R1P_B;  1R1P_C;  1R1P_D;  2AOB_A;  2AOB_B;  2AOB_C;  2AOB_D;  3N84_A;  3N84_B;  3N84_C;  3N84_D;  3N84_E;  3N84_F;  3N7Y_A;  3N7Y_B;  3N7Y_C;  1JYQ_A;  1JYQ_B;  3N8M_A;  1R1S_A;  1R1S_C;  1R1S_E;  1R1S_G;  2H46_E;  3IMD_A;  3IMD_B;  2HUW_A;  2HUW_B;  3KFJ_A;  3IMJ_A;  3IMJ_B;  3MXC_A;  6ICH_A;  1BM2_A;  1TZE_E;  3IN7_A;  3IN7_C;  2AOA_A;  2AOA_B;  3MXY_A;  1FYR_B;  1FYR_C;  1FYR_D;  5CDW_A;  5CDW_B;  5CDW_C;  5CDW_E;  5CDW_G;  5CDW_H;  5CDW_K;  5CDW_L;  5CDW_O;  5CDW_P;  5CDW_U;  5CDW_V;  5CDW_Y;  5CDW_Z;  5CDW_c;  5CDW_d;  1JYU_A;  2H5K_A;  2H5K_B;  1CJ1_A;  1CJ1_B;  1CJ1_C;  1CJ1_D;  1CJ1_E;  1CJ1_F;  1CJ1_G;  1CJ1_H;  1CJ1_I;  1CJ1_J;  1CJ1_K;  1CJ1_L;  1X0N_A;  1QG1_E;  1FHS_A;  1GHU_A;  6ICG_A;  6ICG_B;  5GJH_A;  5GJH_C;  3WA4_A;  3OV1_A;  1JYR_A;  4P9V_A;  3IN8_A;  3S8N_A;  3S8O_A;  3S8L_A;  3C7I_A;  1ZFP_E;  1R1Q_A;  1R1Q_B;  4P9Z_A;  1BMB_A;  3OVE_A;  1R1P_A;  1R1P_B;  1R1P_C;  1R1P_D;  2AOB_A;  2AOB_B;  2AOB_C;  2AOB_D;  3N84_A;  3N84_B;  3N84_C;  3N84_D;  3N84_E;  3N84_F;  3N7Y_A;  3N7Y_B;  3N7Y_C;  1JYQ_A;  1JYQ_B;  3N8M_A;  1R1S_A;  1R1S_C;  1R1S_E;  1R1S_G;  2H46_E;  3IMD_A;  3IMD_B;  2HUW_A;  2HUW_B;  3KFJ_A;  3IMJ_A;  3IMJ_B;  3MXC_A;  6ICH_A;  1BM2_A;  1TZE_E;  3IN7_A;  3IN7_C;  2AOA_A;  2AOA_B;  3MXY_A;  1FYR_A;  1FYR_C;  1FYR_D;  5CDW_A;  5CDW_B;  5CDW_C;  5CDW_E;  5CDW_G;  5CDW_H;  5CDW_K;  5CDW_L;  5CDW_O;  5CDW_P;  5CDW_U;  5CDW_V;  5CDW_Y;  5CDW_Z;  5CDW_c;  5CDW_d;  1JYU_A;  2H5K_A;  2H5K_B;  1CJ1_A;  1CJ1_B;  1CJ1_C;  1CJ1_D;  1CJ1_E;  1CJ1_F;  1CJ1_G;  1CJ1_H;  1CJ1_I;  1CJ1_J;  1CJ1_K;  1CJ1_L;  1X0N_A;  1QG1_E;  1FHS_A;  1GHU_A;  6ICG_A;  6ICG_B;  5GJH_A;  5GJH_C;  3WA4_A;  3OV1_A;  1JYR_A;  4P9V_A;  3IN8_A;  3S8N_A;  3S8O_A;  3S8L_A;  3C7I_A;  1ZFP_E;  1R1Q_A;  1R1Q_B;  4P9Z_A;  1BMB_A;  3OVE_A;  1R1P_A;  1R1P_B;  1R1P_C;  1R1P_D;  2AOB_A;  2AOB_B;  2AOB_C;  2AOB_D;  3N84_A;  3N84_B;  3N84_C;  3N84_D;  3N84_E;  3N84_F;  3N7Y_A;  3N7Y_B;  3N7Y_C;  1JYQ_A;  1JYQ_B;  3N8M_A;  1R1S_A;  1R1S_C;  1R1S_E;  1R1S_G;  2H46_E;  3IMD_A;  3IMD_B;  2HUW_A;  2HUW_B;  3KFJ_A;  3IMJ_A;  3IMJ_B;  3MXC_A;  6ICH_A;  1BM2_A;  1TZE_E;  3IN7_A;  3IN7_C;  2AOA_A;  2AOA_B;  3MXY_A;  1FYR_A;  1FYR_B;  1FYR_D;  5CDW_A;  5CDW_B;  5CDW_C;  5CDW_E;  5CDW_G;  5CDW_H;  5CDW_K;  5CDW_L;  5CDW_O;  5CDW_P;  5CDW_U;  5CDW_V;  5CDW_Y;  5CDW_Z;  5CDW_c;  5CDW_d;  1JYU_A;  2H5K_A;  2H5K_B;  1CJ1_A;  1CJ1_B;  1CJ1_C;  1CJ1_D;  1CJ1_E;  1CJ1_F;  1CJ1_G;  1CJ1_H;  1CJ1_I;  1CJ1_J;  1CJ1_K;  1CJ1_L;  1X0N_A;  1QG1_E;  1FHS_A;  1GHU_A;  6ICG_A;  6ICG_B;  5GJH_A;  5GJH_C;  3WA4_A;  3OV1_A;  1JYR_A;  4P9V_A;  3IN8_A;  3S8N_A;  3S8O_A;  3S8L_A;  3C7I_A;  1ZFP_E;  1R1Q_A;  1R1Q_B;  4P9Z_A;  1BMB_A;  3OVE_A;  1R1P_A;  1R1P_B;  1R1P_C;  1R1P_D;  2AOB_A;  2AOB_B;  2AOB_C;  2AOB_D;  3N84_A;  3N84_B;  3N84_C;  3N84_D;  3N84_E;  3N84_F;  3N7Y_A;  3N7Y_B;  3N7Y_C;  1JYQ_A;  1JYQ_B;  3N8M_A;  1R1S_A;  1R1S_C;  1R1S_E;  1R1S_G;  2H46_E;  3IMD_A;  3IMD_B;  2HUW_A;  2HUW_B;  3KFJ_A;  3IMJ_A;  3IMJ_B;  3MXC_A;  6ICH_A;  1BM2_A;  1TZE_E;  3IN7_A;  3IN7_C;  2AOA_A;  2AOA_B;  3MXY_A;  1FYR_A;  1FYR_B;  1FYR_C;  5CDW_A;  5CDW_B;  5CDW_C;  5CDW_E;  5CDW_G;  5CDW_H;  5CDW_K;  5CDW_L;  5CDW_O;  5CDW_P;  5CDW_U;  5CDW_V;  5CDW_Y;  5CDW_Z;  5CDW_c;  5CDW_d;  1JYU_A;  2H5K_A;  2H5K_B;  1CJ1_A;  1CJ1_B;  1CJ1_C;  1CJ1_D;  1CJ1_E;  1CJ1_F;  1CJ1_G;  1CJ1_H;  1CJ1_I;  1CJ1_J;  1CJ1_K;  1CJ1_L;  1X0N_A;  1QG1_E;  1FHS_A;  1GHU_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling