3E3QbLY

Structure of the 3alpham13 high-affinity mutant of the 2c tcr in complex with ld/ql9
Link type Probability Chain b piercings Chain L piercings Chain Y piercings
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
view details
Unlink Unlink 23% +33b -176b
Interpreting sequences
Chain b Sequence
QLSPFPFDL
Chain b Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Chain b Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
sequence length 9,175,175
structure length 9,175,175
publication title Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation.
pubmed rcsb
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, L-D alpha chain
source organism Mus musculus
pdb deposition date2008-08-07
LinkProt deposition date2016-08-19

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
bLY PF00129 MHC_IClass I Histocompatibility antigen, domains alpha 1 and 2
bLY PF00129 MHC_IClass I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 Murine Class I Major Histocompatibility Complex, H2-DB, subunit A, domain 1 3e3qL00
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 Murine Class I Major Histocompatibility Complex, H2-DB, subunit A, domain 1 3e3qY00
3HPJBDE 1AGBAC 3E2HABQ 3FT3AP 3DXAKM 3H9HBDF 3DX7AC 3DXAACD 3E3QbY 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAFG 1A9BAC 3GJFDF 3DXAABC 3GIVAD 3H7BACE 1A1MABC 3HAEABC 3HAEDFG 3E3QBFG 1AGBABC 3FQRAC 1A1OAC 3GSNHP 3E3QBG 3E3QHIK 3FFCFH 1AGEAC 1A9BBDF 3HPJDEF 3GSUAB 3GSOAP 3HAEDFN 3FQTAB 3HAEDE 3E3QPRT 3HAEACL 3E3QHPT 3DXAIKM 3FRUCD 3IXACDF 3E3QKPT 1A1NABC 3E3QLOY 3JTTDEI 3H9SACE 3FQNAC 3FRUAD 1AGDAC 3DX8AB 3HCVABC 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3FFCABC 3H9HDF 1A9EAB 3HPJAB 3HPJADF 3IXAABD 3JTTACI 1A9BABC 3FQUAB 3HAEDFI 3FONCD 3H9HAC 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 1A1MAC 3H7BDE 3H7BABD 3E3Qcf 3FQWAC 3E3QDHK 3E3QUWX 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 3FOMAB 3HPJACE 3H9SACD 3FT4AP 3JTTCDI 3GIVADF 3HAEPQ 3GSVAP 3GSNAHP 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3DX6AB 3FRUABD 3JTTDE 3DXAACH 3E3QPT 1AGDABC 3GSXAP 3E3Qcef 3JTTGH 3DX7ABC 3JTTAB 3DXAKMO 3E3QHKP 3H9HABC 3FQXAB 3FRUABC 3JTTCDG 3HAEGJK 3FFCCFH 3E3QUVX 3JTTDEG 3HAEDFK 3GSVAB 3DXAJKM 1A1NAB 3H9HDEF 3FT3AB 3JTTADE 3GIVABD 3IXADF 3H7BADF 3HAEJKM 3HAEJMN 3GSOABP 3JTTBDE 3E3QLY 3GSQAB 3JTTAGI 3FQRABC 3H9HAD 3DX8ABC 3E3QUX 3E3QAEQ 3GIVDEF 3HAEACH 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3FFCFG 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3H7BAB 1A9EABC 3HPJABC 3IXAACD 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 3DXAAKM 1A9BAB 3FFCFHI 3FOLAP 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3GIVAC 3IXAADE 3DXAFGH 3HCVAB 3GJFDEF 3GJFDFK 3GIVACD 3GJFAB 3FT2AB 3FFCBFH 3HAEPQR 3HG1ABC 1AGFAC 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3HLAAB 3GSNHL 3FT2ABP 3FOLAB 3E3QKP 3JTTBDG 3JTTCGH 3GSWABP 1AGCABC 3GJFDEH 3JTTAC 3DX6ABC 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3JTTABC 3E3QBCG 3FRUAB 3H9HACD 3IXAAC 3H9HDE 1A9EAC 3DXAFH 3GSVABP 3IXAABE 3DXAACL 3H9HAB 3FQXAC 3H7BACD 3JTTACH 3FONCE 3H7BAC 3FT4ABP 3FQRAB 1A1OAB 3E3QHKT 1A9BCDF 3GIVABC 3GSXABP 3IXABDF 1AGEAB 3GSRAB 3E3QADQ 3FQWAB 3E3QAQ 3E2HAQ 3FT4AB 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FFCACF 3GSUABP 3FONAB 3GSNBHP 3E3QLO 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 3HPJAC 3GSQAP 3FONAP 1A1NAC 3HPJADE 3IXAABC 3GJFACH 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1A1MAB 3HAEJMO 3JTTAGH 3H7BDF 3IXADE 3HCVAC 3HG1AC 3E3QPST 3JTTAEI 3HG1ACD 3FFCAC 3FQTABC 3JTTAFG 3HAEPRS 3FQXABC 3DXAACF 3GIVADE 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3JTTAD 3GIVDE 3HAEAC 3FOMAP 3DX6AC 3E3QbLY 3FOLABP 1A1OABC 3GIVAB 3GJFDFM 3E3QbL 3FONACE 3JTTGI 1AGEABC 3GJFAC 3GSRABP 3GSOAB 3HAEACG 3JTTCDF 1AGFAB 3JTTDEF 3FONABP 3DXAFHJ 3FFCACI 3FQUABC 3E3QHK 3JTTBDF 3DXADKM 3DXAEFH 3H7BABC
chains in the LinkProt database with same CATH superfamily
3HPJBDE 1AGBAC 3E2HABQ 3FT3AP 3DXAKM 3H9HBDF 3DX7AC 3DXAACD 3E3QbY 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAFG 1A9BAC 3GJFDF 3DXAABC 3GIVAD 3H7BACE 1A1MABC 3HAEABC 3HAEDFG 3E3QBFG 1AGBABC 3FQRAC 1A1OAC 3GSNHP 3E3QBG 3E3QHIK 3FFCFH 1AGEAC 1A9BBDF 3HPJDEF 3GSUAB 3GSOAP 3HAEDFN 3FQTAB 3HAEDE 3E3QPRT 3HAEACL 3E3QHPT 3DXAIKM 3FRUCD 3IXACDF 3E3QKPT 1A1NABC 3E3QLOY 3JTTDEI 3H9SACE 3FQNAC 3FRUAD 1AGDAC 3DX8AB 3HCVABC 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3FFCABC 3H9HDF 1A9EAB 3HPJAB 3HPJADF 3IXAABD 3JTTACI 1A9BABC 3FQUAB 3HAEDFI 3FONCD 3H9HAC 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 1A1MAC 3H7BDE 3H7BABD 3E3Qcf 3FQWAC 3E3QDHK 3E3QUWX 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 3FOMAB 3HPJACE 3H9SACD 3FT4AP 3JTTCDI 3GIVADF 3HAEPQ 3GSVAP 3GSNAHP 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3DX6AB 3FRUABD 3JTTDE 3DXAACH 3E3QPT 1AGDABC 3GSXAP 3E3Qcef 3JTTGH 3DX7ABC 3JTTAB 3DXAKMO 3E3QHKP 3H9HABC 3FQXAB 3FRUABC 3JTTCDG 3HAEGJK 3FFCCFH 3E3QUVX 3JTTDEG 3HAEDFK 3GSVAB 3DXAJKM 1A1NAB 3H9HDEF 3FT3AB 3JTTADE 3GIVABD 3IXADF 3H7BADF 3HAEJKM 3HAEJMN 3GSOABP 3JTTBDE 3E3QLY 3GSQAB 3JTTAGI 3FQRABC 3H9HAD 3DX8ABC 3E3QUX 3E3QAEQ 3GIVDEF 3HAEACH 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3FFCFG 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3H7BAB 1A9EABC 3HPJABC 3IXAACD 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 3DXAAKM 1A9BAB 3FFCFHI 3FOLAP 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3GIVAC 3IXAADE 3DXAFGH 3HCVAB 3GJFDEF 3GJFDFK 3GIVACD 3GJFAB 3FT2AB 3FFCBFH 3HAEPQR 3HG1ABC 1AGFAC 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3HLAAB 3GSNHL 3FT2ABP 3FOLAB 3E3QKP 3JTTBDG 3JTTCGH 3GSWABP 1AGCABC 3GJFDEH 3JTTAC 3DX6ABC 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3JTTABC 3E3QBCG 3FRUAB 3H9HACD 3IXAAC 3H9HDE 1A9EAC 3DXAFH 3GSVABP 3IXAABE 3DXAACL 3H9HAB 3FQXAC 3H7BACD 3JTTACH 3FONCE 3H7BAC 3FT4ABP 3FQRAB 1A1OAB 3E3QHKT 1A9BCDF 3GIVABC 3GSXABP 3IXABDF 1AGEAB 3GSRAB 3E3QADQ 3FQWAB 3E3QAQ 3E2HAQ 3FT4AB 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FFCACF 3GSUABP 3FONAB 3GSNBHP 3E3QLO 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 3HPJAC 3GSQAP 3FONAP 1A1NAC 3HPJADE 3IXAABC 3GJFACH 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1A1MAB 3HAEJMO 3JTTAGH 3H7BDF 3IXADE 3HCVAC 3HG1AC 3E3QPST 3JTTAEI 3HG1ACD 3FFCAC 3FQTABC 3JTTAFG 3HAEPRS 3FQXABC 3DXAACF 3GIVADE 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3JTTAD 3GIVDE 3HAEAC 3FOMAP 3DX6AC 3E3QbLY 3FOLABP 1A1OABC 3GIVAB 3GJFDFM 3E3QbL 3FONACE 3JTTGI 1AGEABC 3GJFAC 3GSRABP 3GSOAB 3HAEACG 3JTTCDF 1AGFAB 3JTTDEF 3FONABP 3DXAFHJ 3FFCACI 3FQUABC 3E3QHK 3JTTBDF 3DXADKM 3DXAEFH 3H7BABC
chains in the LinkProt database with same CATH topology
3HPJBDE 1AGBAC 3E2HABQ 3FT3AP 3DXAKM 3H9HBDF 3DX7AC 3DXAACD 3E3QbY 3FONACP 3GSUAP 3FFCACG 3H9HACE 3IXAAB 3E3QHJK 3DXAFG 1A9BAC 3GJFDF 3DXAABC 3GIVAD 3H7BACE 1A1MABC 3HAEABC 3HAEDFG 3E3QBFG 1AGBABC 3FQRAC 1A1OAC 3GSNHP 3E3QBG 3E3QHIK 3FFCFH 1AGEAC 1A9BBDF 3HPJDEF 3GSUAB 3GSOAP 3HAEDFN 3FQTAB 3HAEDE 3E3QPRT 3HAEACL 3E3QHPT 3DXAIKM 3FRUCD 3IXACDF 3E3QKPT 1A1NABC 3E3QLOY 3JTTDEI 3H9SACE 3FQNAC 3FRUAD 1AGDAC 3DX8AB 3HCVABC 3JTTDGH 3JTTDG 3DXAACJ 3H9HADF 3JTTDFH 3FT3ABP 3HPJDE 3FFCABC 3H9HDF 1A9EAB 3HPJAB 3HPJADF 3IXAABD 3JTTACI 1A9BABC 3FQUAB 3HAEDFI 3FONCD 3H9HAC 3DXAFHI 3DXAAC 1A9BDEF 3JTTADG 1A1MAC 3H7BDE 3H7BABD 3E3Qcf 3FQWAC 3E3QDHK 3E3QUWX 3HAEACP 3GSWAB 3H7BDEF 3H9SAC 3HG1AB 3HAEACJ 3DXAKLM 3FOMAB 3HPJACE 3H9SACD 3FT4AP 3JTTCDI 3GIVADF 3HAEPQ 3GSVAP 3GSNAHP 1AGCAB 3GIVDF 3JTTAEG 3HAEAB 3DX6AB 3FRUABD 3JTTDE 3DXAACH 3E3QPT 1AGDABC 3GSXAP 3E3Qcef 3JTTGH 3DX7ABC 3JTTAB 3DXAKMO 3E3QHKP 3H9HABC 3FQXAB 3FRUABC 3JTTCDG 3HAEGJK 3FFCCFH 3E3QUVX 3JTTDEG 3HAEDFK 3GSVAB 3DXAJKM 1A1NAB 3H9HDEF 3FT3AB 3JTTADE 3GIVABD 3IXADF 3H7BADF 3HAEJKM 3HAEJMN 3GSOABP 3JTTBDE 3E3QLY 3GSQAB 3JTTAGI 3FQRABC 3H9HAD 3DX8ABC 3E3QUX 3E3QAEQ 3GIVDEF 3HAEACH 1AGBAB 3FQWABC 3E2HACQ 3HG1ACE 3FFCAB 3FFCFG 3JTTEG 3HAEPRT 3H9SABC 3FONCDE 3H7BAB 1A9EABC 3HPJABC 3IXAACD 3GSQABP 3IXADEF 3FFCACD 3GSNHLP 3DXAAKM 1A9BAB 3FFCFHI 3FOLAP 3FQNABC 3GJFDE 1A9BADF 3HAEDEF 3GJFACL 3GIVAC 3IXAADE 3DXAFGH 3HCVAB 3GJFDEF 3GJFDFK 3GIVACD 3GJFAB 3FT2AB 3FFCBFH 3HAEPQR 3HG1ABC 1AGFAC 3HAEDFM 1A9BACF 3FQTAC 3HAEDF 3HLAAB 3GSNHL 3FT2ABP 3FOLAB 3E3QKP 3JTTBDG 3JTTCGH 3GSWABP 1AGCABC 3GJFDEH 3JTTAC 3DX6ABC 3FT2AP 3HAEJK 3HAEAJM 1AGDAB 3FRUACD 3DXAKL 3JTTAFH 3FFCFGH 3DX7AB 3GSRAP 3DXAACK 3H9HADE 3JTTDFG 3HPJDF 3JTTABC 3E3QBCG 3FRUAB 3H9HACD 3IXAAC 3H9HDE 1A9EAC 3DXAFH 3GSVABP 3IXAABE 3DXAACL 3H9HAB 3FQXAC 3H7BACD 3JTTACH 3FONCE 3H7BAC 3FT4ABP 3FQRAB 1A1OAB 3E3QHKT 1A9BCDF 3GIVABC 3GSXABP 3IXABDF 1AGEAB 3GSRAB 3E3QADQ 3FQWAB 3E3QAQ 3E2HAQ 3FT4AB 3JTTCEG 3FFCDFH 1A9BACD 3H9SAB 3FFCACJ 1AGFABC 3FFCACF 3GSUABP 3FONAB 3GSNBHP 3E3QLO 3GSXAB 3FOMABP 3DXACKM 3HAEPR 3FQNAB 1A9BDE 3HAEJM 1AGCAC 3HAEDFL 3JTTAEF 3DX8AC 3HPJAD 3GJFABC 3JTTDF 3JTTDFI 3E3Qcdf 3HPJAC 3GSQAP 3FONAP 1A1NAC 3HPJADE 3IXAABC 3GJFACH 3H7BACF 3FQUAC 3HPJACD 3FRUBCD 3HAEDFP 3IXAADF 3DXAAB 3JTTADF 1A1MAB 3HAEJMO 3JTTAGH 3H7BDF 3IXADE 3HCVAC 3HG1AC 3E3QPST 3JTTAEI 3HG1ACD 3FFCAC 3FQTABC 3JTTAFG 3HAEPRS 3FQXABC 3DXAACF 3GIVADE 3FRUEF 1A9BDF 3FFCACE 3GSWAP 3IXAAD 3JTTAD 3GIVDE 3HAEAC 3FOMAP 3DX6AC 3E3QbLY 3FOLABP 1A1OABC 3GIVAB 3GJFDFM 3E3QbL 3FONACE 3JTTGI 1AGEABC 3GJFAC 3GSRABP 3GSOAB 3HAEACG 3JTTCDF 1AGFAB 3JTTDEF 3FONABP 3DXAFHJ 3FFCACI 3FQUABC 3E3QHK 3JTTBDF 3DXADKM 3DXAEFH 3H7BABC
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  3FT3 AP;  3DXA KM;  3H9H BDF;  3DX7 AC;  3DXA ACD;  3E3Q bY;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA FG;  1A9B AC;  3GJF DF;  3DXA ABC;  3GIV AD;  3H7B ACE;  1A1M ABC;  3HAE ABC;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3FQR AC;  1A1O AC;  3GSN HP;  3E3Q BG;  3E3Q HIK;  3FFC FH;  1AGE AC;  1A9B BDF;  3HPJ DEF;  3GSU AB;  3GSO AP;  3HAE DFN;  3FQT AB;  3HAE DE;  3E3Q PRT;  3HAE ACL;  3E3Q HPT;  3DXA IKM;  3FRU CD;  3IXA CDF;  3E3Q KPT;  1A1N ABC;  3E3Q LOY;  3JTT DEI;  3H9S ACE;  3FQN AC;  3FRU AD;  1AGD AC;  3DX8 AB;  3HCV ABC;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3FFC ABC;  3H9H DF;  1A9E AB;  3HPJ AB;  3HPJ ADF;  3IXA ABD;  3JTT ACI;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FON CD;  3H9H AC;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  1A1M AC;  3H7B DE;  3H7B ABD;  3E3Q cf;  3FQW AC;  3E3Q DHK;  3E3Q UWX;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  3JTT CDI;  3GIV ADF;  3HAE PQ;  3GSV AP;  3GSN AHP;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3DX6 AB;  3FRU ABD;  3JTT DE;  3DXA ACH;  3E3Q PT;  1AGD ABC;  3GSX AP;  3E3Q cef;  3JTT GH;  3DX7 ABC;  3JTT AB;  3DXA KMO;  3E3Q HKP;  3H9H ABC;  3FQX AB;  3FRU ABC;  3JTT CDG;  3HAE GJK;  3FFC CFH;  3E3Q UVX;  3JTT DEG;  3HAE DFK;  3GSV AB;  3DXA JKM;  1A1N AB;  3H9H DEF;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IXA DF;  3H7B ADF;  3HAE JKM;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3E3Q LY;  3GSQ AB;  3JTT AGI;  3FQR ABC;  3H9H AD;  3DX8 ABC;  3E3Q UX;  3E3Q AEQ;  3GIV DEF;  3HAE ACH;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3FFC FG;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3H7B AB;  1A9E ABC;  3HPJ ABC;  3IXA ACD;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  3DXA AKM;  1A9B AB;  3FFC FHI;  3FOL AP;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3GIV AC;  3IXA ADE;  3DXA FGH;  3HCV AB;  3GJF DEF;  3GJF DFK;  3GIV ACD;  3GJF AB;  3FT2 AB;  3FFC BFH;  3HAE PQR;  3HG1 ABC;  1AGF AC;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3HLA AB;  3GSN HL;  3FT2 ABP;  3FOL AB;  3E3Q KP;  3JTT BDG;  3JTT CGH;  3GSW ABP;  1AGC ABC;  3GJF DEH;  3JTT AC;  3DX6 ABC;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3JTT ABC;  3E3Q BCG;  3FRU AB;  3H9H ACD;  3IXA AC;  3H9H DE;  1A9E AC;  3DXA FH;  3GSV ABP;  3IXA ABE;  3DXA ACL;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  1A1O AB;  3E3Q HKT;  1A9B CDF;  3GIV ABC;  3GSX ABP;  3IXA BDF;  1AGE AB;  3GSR AB;  3E3Q ADQ;  3FQW AB;  3E3Q AQ;  3E2H AQ;  3FT4 AB;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FFC ACF;  3GSU ABP;  3FON AB;  3GSN BHP;  3E3Q LO;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  3HPJ AC;  3GSQ AP;  3FON AP;  1A1N AC;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1A1M AB;  3HAE JMO;  3JTT AGH;  3H7B DF;  3IXA DE;  3HCV AC;  3HG1 AC;  3E3Q PST;  3JTT AEI;  3HG1 ACD;  3FFC AC;  3FQT ABC;  3JTT AFG;  3HAE PRS;  3FQX ABC;  3DXA ACF;  3GIV ADE;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3JTT AD;  3GIV DE;  3HAE AC;  3FOM AP;  3DX6 AC;  3E3Q bLY;  3FOL ABP;  1A1O ABC;  3GIV AB;  3GJF DFM;  3E3Q bL;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  3GSR ABP;  3GSO AB;  3HAE ACG;  3JTT CDF;  1AGF AB;  3JTT DEF;  3FON ABP;  3DXA FHJ;  3FFC ACI;  3FQU ABC;  3E3Q HK;  3JTT BDF;  3DXA DKM;  3DXA EFH;  3H7B ABC; 
#chains in the LinkProt database with same CATH topology
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  3FT3 AP;  3DXA KM;  3H9H BDF;  3DX7 AC;  3DXA ACD;  3E3Q bY;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA FG;  1A9B AC;  3GJF DF;  3DXA ABC;  3GIV AD;  3H7B ACE;  1A1M ABC;  3HAE ABC;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3FQR AC;  1A1O AC;  3GSN HP;  3E3Q BG;  3E3Q HIK;  3FFC FH;  1AGE AC;  1A9B BDF;  3HPJ DEF;  3GSU AB;  3GSO AP;  3HAE DFN;  3FQT AB;  3HAE DE;  3E3Q PRT;  3HAE ACL;  3E3Q HPT;  3DXA IKM;  3FRU CD;  3IXA CDF;  3E3Q KPT;  1A1N ABC;  3E3Q LOY;  3JTT DEI;  3H9S ACE;  3FQN AC;  3FRU AD;  1AGD AC;  3DX8 AB;  3HCV ABC;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3FFC ABC;  3H9H DF;  1A9E AB;  3HPJ AB;  3HPJ ADF;  3IXA ABD;  3JTT ACI;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FON CD;  3H9H AC;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  1A1M AC;  3H7B DE;  3H7B ABD;  3E3Q cf;  3FQW AC;  3E3Q DHK;  3E3Q UWX;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  3JTT CDI;  3GIV ADF;  3HAE PQ;  3GSV AP;  3GSN AHP;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3DX6 AB;  3FRU ABD;  3JTT DE;  3DXA ACH;  3E3Q PT;  1AGD ABC;  3GSX AP;  3E3Q cef;  3JTT GH;  3DX7 ABC;  3JTT AB;  3DXA KMO;  3E3Q HKP;  3H9H ABC;  3FQX AB;  3FRU ABC;  3JTT CDG;  3HAE GJK;  3FFC CFH;  3E3Q UVX;  3JTT DEG;  3HAE DFK;  3GSV AB;  3DXA JKM;  1A1N AB;  3H9H DEF;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IXA DF;  3H7B ADF;  3HAE JKM;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3E3Q LY;  3GSQ AB;  3JTT AGI;  3FQR ABC;  3H9H AD;  3DX8 ABC;  3E3Q UX;  3E3Q AEQ;  3GIV DEF;  3HAE ACH;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3FFC FG;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3H7B AB;  1A9E ABC;  3HPJ ABC;  3IXA ACD;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  3DXA AKM;  1A9B AB;  3FFC FHI;  3FOL AP;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3GIV AC;  3IXA ADE;  3DXA FGH;  3HCV AB;  3GJF DEF;  3GJF DFK;  3GIV ACD;  3GJF AB;  3FT2 AB;  3FFC BFH;  3HAE PQR;  3HG1 ABC;  1AGF AC;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3HLA AB;  3GSN HL;  3FT2 ABP;  3FOL AB;  3E3Q KP;  3JTT BDG;  3JTT CGH;  3GSW ABP;  1AGC ABC;  3GJF DEH;  3JTT AC;  3DX6 ABC;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3JTT ABC;  3E3Q BCG;  3FRU AB;  3H9H ACD;  3IXA AC;  3H9H DE;  1A9E AC;  3DXA FH;  3GSV ABP;  3IXA ABE;  3DXA ACL;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  1A1O AB;  3E3Q HKT;  1A9B CDF;  3GIV ABC;  3GSX ABP;  3IXA BDF;  1AGE AB;  3GSR AB;  3E3Q ADQ;  3FQW AB;  3E3Q AQ;  3E2H AQ;  3FT4 AB;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FFC ACF;  3GSU ABP;  3FON AB;  3GSN BHP;  3E3Q LO;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  3HPJ AC;  3GSQ AP;  3FON AP;  1A1N AC;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1A1M AB;  3HAE JMO;  3JTT AGH;  3H7B DF;  3IXA DE;  3HCV AC;  3HG1 AC;  3E3Q PST;  3JTT AEI;  3HG1 ACD;  3FFC AC;  3FQT ABC;  3JTT AFG;  3HAE PRS;  3FQX ABC;  3DXA ACF;  3GIV ADE;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3JTT AD;  3GIV DE;  3HAE AC;  3FOM AP;  3DX6 AC;  3E3Q bLY;  3FOL ABP;  1A1O ABC;  3GIV AB;  3GJF DFM;  3E3Q bL;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  3GSR ABP;  3GSO AB;  3HAE ACG;  3JTT CDF;  1AGF AB;  3JTT DEF;  3FON ABP;  3DXA FHJ;  3FFC ACI;  3FQU ABC;  3E3Q HK;  3JTT BDF;  3DXA DKM;  3DXA EFH;  3H7B ABC; 
#chains in the LinkProt database with same CATH homology
 3HPJ BDE;  1AGB AC;  3E2H ABQ;  3FT3 AP;  3DXA KM;  3H9H BDF;  3DX7 AC;  3DXA ACD;  3E3Q bY;  3FON ACP;  3GSU AP;  3FFC ACG;  3H9H ACE;  3IXA AB;  3E3Q HJK;  3DXA FG;  1A9B AC;  3GJF DF;  3DXA ABC;  3GIV AD;  3H7B ACE;  1A1M ABC;  3HAE ABC;  3HAE DFG;  3E3Q BFG;  1AGB ABC;  3FQR AC;  1A1O AC;  3GSN HP;  3E3Q BG;  3E3Q HIK;  3FFC FH;  1AGE AC;  1A9B BDF;  3HPJ DEF;  3GSU AB;  3GSO AP;  3HAE DFN;  3FQT AB;  3HAE DE;  3E3Q PRT;  3HAE ACL;  3E3Q HPT;  3DXA IKM;  3FRU CD;  3IXA CDF;  3E3Q KPT;  1A1N ABC;  3E3Q LOY;  3JTT DEI;  3H9S ACE;  3FQN AC;  3FRU AD;  1AGD AC;  3DX8 AB;  3HCV ABC;  3JTT DGH;  3JTT DG;  3DXA ACJ;  3H9H ADF;  3JTT DFH;  3FT3 ABP;  3HPJ DE;  3FFC ABC;  3H9H DF;  1A9E AB;  3HPJ AB;  3HPJ ADF;  3IXA ABD;  3JTT ACI;  1A9B ABC;  3FQU AB;  3HAE DFI;  3FON CD;  3H9H AC;  3DXA FHI;  3DXA AC;  1A9B DEF;  3JTT ADG;  1A1M AC;  3H7B DE;  3H7B ABD;  3E3Q cf;  3FQW AC;  3E3Q DHK;  3E3Q UWX;  3HAE ACP;  3GSW AB;  3H7B DEF;  3H9S AC;  3HG1 AB;  3HAE ACJ;  3DXA KLM;  3FOM AB;  3HPJ ACE;  3H9S ACD;  3FT4 AP;  3JTT CDI;  3GIV ADF;  3HAE PQ;  3GSV AP;  3GSN AHP;  1AGC AB;  3GIV DF;  3JTT AEG;  3HAE AB;  3DX6 AB;  3FRU ABD;  3JTT DE;  3DXA ACH;  3E3Q PT;  1AGD ABC;  3GSX AP;  3E3Q cef;  3JTT GH;  3DX7 ABC;  3JTT AB;  3DXA KMO;  3E3Q HKP;  3H9H ABC;  3FQX AB;  3FRU ABC;  3JTT CDG;  3HAE GJK;  3FFC CFH;  3E3Q UVX;  3JTT DEG;  3HAE DFK;  3GSV AB;  3DXA JKM;  1A1N AB;  3H9H DEF;  3FT3 AB;  3JTT ADE;  3GIV ABD;  3IXA DF;  3H7B ADF;  3HAE JKM;  3HAE JMN;  3GSO ABP;  3JTT BDE;  3E3Q LY;  3GSQ AB;  3JTT AGI;  3FQR ABC;  3H9H AD;  3DX8 ABC;  3E3Q UX;  3E3Q AEQ;  3GIV DEF;  3HAE ACH;  1AGB AB;  3FQW ABC;  3E2H ACQ;  3HG1 ACE;  3FFC AB;  3FFC FG;  3JTT EG;  3HAE PRT;  3H9S ABC;  3FON CDE;  3H7B AB;  1A9E ABC;  3HPJ ABC;  3IXA ACD;  3GSQ ABP;  3IXA DEF;  3FFC ACD;  3GSN HLP;  3DXA AKM;  1A9B AB;  3FFC FHI;  3FOL AP;  3FQN ABC;  3GJF DE;  1A9B ADF;  3HAE DEF;  3GJF ACL;  3GIV AC;  3IXA ADE;  3DXA FGH;  3HCV AB;  3GJF DEF;  3GJF DFK;  3GIV ACD;  3GJF AB;  3FT2 AB;  3FFC BFH;  3HAE PQR;  3HG1 ABC;  1AGF AC;  3HAE DFM;  1A9B ACF;  3FQT AC;  3HAE DF;  3HLA AB;  3GSN HL;  3FT2 ABP;  3FOL AB;  3E3Q KP;  3JTT BDG;  3JTT CGH;  3GSW ABP;  1AGC ABC;  3GJF DEH;  3JTT AC;  3DX6 ABC;  3FT2 AP;  3HAE JK;  3HAE AJM;  1AGD AB;  3FRU ACD;  3DXA KL;  3JTT AFH;  3FFC FGH;  3DX7 AB;  3GSR AP;  3DXA ACK;  3H9H ADE;  3JTT DFG;  3HPJ DF;  3JTT ABC;  3E3Q BCG;  3FRU AB;  3H9H ACD;  3IXA AC;  3H9H DE;  1A9E AC;  3DXA FH;  3GSV ABP;  3IXA ABE;  3DXA ACL;  3H9H AB;  3FQX AC;  3H7B ACD;  3JTT ACH;  3FON CE;  3H7B AC;  3FT4 ABP;  3FQR AB;  1A1O AB;  3E3Q HKT;  1A9B CDF;  3GIV ABC;  3GSX ABP;  3IXA BDF;  1AGE AB;  3GSR AB;  3E3Q ADQ;  3FQW AB;  3E3Q AQ;  3E2H AQ;  3FT4 AB;  3JTT CEG;  3FFC DFH;  1A9B ACD;  3H9S AB;  3FFC ACJ;  1AGF ABC;  3FFC ACF;  3GSU ABP;  3FON AB;  3GSN BHP;  3E3Q LO;  3GSX AB;  3FOM ABP;  3DXA CKM;  3HAE PR;  3FQN AB;  1A9B DE;  3HAE JM;  1AGC AC;  3HAE DFL;  3JTT AEF;  3DX8 AC;  3HPJ AD;  3GJF ABC;  3JTT DF;  3JTT DFI;  3E3Q cdf;  3HPJ AC;  3GSQ AP;  3FON AP;  1A1N AC;  3HPJ ADE;  3IXA ABC;  3GJF ACH;  3H7B ACF;  3FQU AC;  3HPJ ACD;  3FRU BCD;  3HAE DFP;  3IXA ADF;  3DXA AB;  3JTT ADF;  1A1M AB;  3HAE JMO;  3JTT AGH;  3H7B DF;  3IXA DE;  3HCV AC;  3HG1 AC;  3E3Q PST;  3JTT AEI;  3HG1 ACD;  3FFC AC;  3FQT ABC;  3JTT AFG;  3HAE PRS;  3FQX ABC;  3DXA ACF;  3GIV ADE;  3FRU EF;  1A9B DF;  3FFC ACE;  3GSW AP;  3IXA AD;  3JTT AD;  3GIV DE;  3HAE AC;  3FOM AP;  3DX6 AC;  3E3Q bLY;  3FOL ABP;  1A1O ABC;  3GIV AB;  3GJF DFM;  3E3Q bL;  3FON ACE;  3JTT GI;  1AGE ABC;  3GJF AC;  3GSR ABP;  3GSO AB;  3HAE ACG;  3JTT CDF;  1AGF AB;  3JTT DEF;  3FON ABP;  3DXA FHJ;  3FFC ACI;  3FQU ABC;  3E3Q HK;  3JTT BDF;  3DXA DKM;  3DXA EFH;  3H7B ABC; 

6L9KA 4MS8A 3ERYA 3ERYB 3TJHA 1TMCA 6L9LA 6L9LE 2OI9A 2E7LE 2E7LF 4MXQA 4N0CA 4N0CE 4N5EA 3TF7A 3TF7E 3TFKA 4MVBA 3TPUE 3TPUI 3TPUK 3TPUQ 3E3QA 3E3QB 3E3QH 3E3QP 3E3QU 3E3QY 3E3Qc 3E2HA 6L9KA 4MS8A 3ERYA 3ERYB 3TJHA 1TMCA 6L9LA 6L9LE 2OI9A 2E7LE 2E7LF 4MXQA 4N0CA 4N0CE 4N5EA 3TF7A 3TF7E 3TFKA 4MVBA 3TPUE 3TPUI 3TPUK 3TPUQ 3E3QA 3E3QB 3E3QH 3E3QL 3E3QP 3E3QU 3E3Qc 3E2HA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6L9K_A;  4MS8_A;  3ERY_A;  3ERY_B;  3TJH_A;  1TMC_A;  6L9L_A;  6L9L_E;  2OI9_A;  2E7L_E;  2E7L_F;  4MXQ_A;  4N0C_A;  4N0C_E;  4N5E_A;  3TF7_A;  3TF7_E;  3TFK_A;  4MVB_A;  3TPU_E;  3TPU_I;  3TPU_K;  3TPU_Q;  3E3Q_A;  3E3Q_B;  3E3Q_H;  3E3Q_P;  3E3Q_U;  3E3Q_Y;  3E3Q_c;  3E2H_A;  6L9K_A;  4MS8_A;  3ERY_A;  3ERY_B;  3TJH_A;  1TMC_A;  6L9L_A;  6L9L_E;  2OI9_A;  2E7L_E;  2E7L_F;  4MXQ_A;  4N0C_A;  4N0C_E;  4N5E_A;  3TF7_A;  3TF7_E;  3TFK_A;  4MVB_A;  3TPU_E;  3TPU_I;  3TPU_K;  3TPU_Q;  3E3Q_A;  3E3Q_B;  3E3Q_H;  3E3Q_L;  3E3Q_P;  3E3Q_U;  3E3Q_c;  3E2H_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling