1OW6AB

Paxillin ld4 motif bound to the focal adhesion targeting (fat) domain of the focal adhesion kinase
Warning
  • Temporary problem with connection to RCSB web service - similar chains cannot be displayed.
  • Temporary problem with connection to RCSB web service - similar chains cannot be displayed.
Link type Probability Chain A piercings Chain B piercings
view details
Unlink Unlink 78% +974B -1048B
view details
Unlink Unlink 78% +974B -1048B
view details
Unlink Unlink 78% +974B -1048B
view details
Unlink Unlink 78% +974B -1048B
view details
Unlink Unlink 78% +974B -1048B
view details
Unlink Unlink 78% +974B -1048B
view details
Unlink Unlink 78% +974B -1048B
Interpreting sequences
Chain A Sequence
NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQT
Chain A Sequence
ISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLG
sequence length 134,139
structure length 134,139
publication title Molecular Recognition of Paxillin LD motifs by the Focal Adhesion Targeting Domain
pubmed doi rcsb
molecule tags Transferase
molecule keywords Focal adhesion kinase 1
source organism Homo sapiens
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date2003-03-28
LinkProt deposition date2016-10-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF03623 Focal_ATFocal adhesion targeting region
AB PF03623 Focal_ATFocal adhesion targeting region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow6A01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow6A02
1.20.5.540 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1ow6B01
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 1ow6B02
1OW6BD 1OW6ABCD 1OW6ABC 1OW6ABDF 1OW6BDF 1OW6ABCF 1OW6ABF 1OW6CF 1OW6BC 1OW6BCF 1OW6BCDF 1OW6ABD 1OW6AD 1OW6BCD 1OW6BF 1OW6AB
chains in the LinkProt database with same CATH superfamily
3JTLFGP 3JTLFRU 3JTLRST 3JSEFNP 3JSEABR 3JTLAFU 3JSEDJT 3JTLAQU 3JTLFIO 1MV8AC 3JSECOS 1MUUBD 3JSETU 3JTLBPR 1MV8ABCD 3JSEFO 3JTLDOP 3JTLSTU 3JTLOT 3JTLEO 3JSEBGR 3JTLESU 3JSEBPR 3JTLBET 3JTLDNP 3JTLFP 1MV8ABC 1AV1BCD 1MUUBCD 3JSEBRS 3EFFBN 3JSEEPS 3JSECQS 3JSEBS 3JSEAFO 3JSEDTU 3JTLCHP 3JTLBMS 3JSEAPQ 3JTLEQT 3JTLBPS 3JSEACQ 3JTLAMR 3JTLDPT 3JTLNPS 3JTLAOR 3JTLCT 3EFFCK 1MFZCD 3JTLAPQ 1MUUCD 3JTLETU 3JTLEU 1AQ5AC 3JSEBDR 1MFZAB 3JSEGPS 3JTLEFT 1OW6ABDF 3JTLDGO 3JTLBFT 1MV8ACD 3JSEDFT 3JSEFJO 3JTLDHQ 3JTLBPT 1OW6CF 3JTLGNT 3JSECES 1OW6ABD 3JTLOU 3JTLDFO 3JSEABQ 3JTLST 1MUUACD 3JSEBCS 3JSEPSU 3JSEIPU 3EFFKN 3JTLGKO 3JTLAP 3JSEEFP 3JTLCQR 3JTLGRU 3JSEGRS 3JTLFQU 1MV8CD 3JSEGP 1MUUAC 3JTLGOP 3EFFKMN 3JTLGIP 3JTLAOU 3JTLATU 3JTLDPR 2DI3AB 1OW6AB 3JSEFNQ 3JSEGOP 3JTLCJR 3JTLDEO 3JSEBEU 3JTLFMP 3JSEBFR 3JTLEGP 1MV8AB 3JSECSU 3JTLBS 3JTLCIQ 3JSEFQR 3JSEDOT 3JTLFPT 3JTLAQ 3JSEADQ 1OW6ABCD 1AQ5BC 3JSEGHQ 3JSEBDT 3JTLDNQ 3EFFDL 3JTLCFP 3JSEGST 3JSEFPU 3JSEBCT 3JSECGS 3JSEST 3JSEDET 1OW6BC 3JSEEOU 3JSEGPQ 3JTLEFP 3JSEEU 3JSEEO 3JTLBSU 3JSEBQR 3JTLCS 3JTLGRS 3JTLRTU 3JTLAPT 3JSEEPU 1MUUABD 3JTLGLP 3JTLAJO 3JTLMQU 3JTLBPQ 3JSEBR 3EFFMN 3EFFAK 3JSELPR 3JSEFNO 3JSEFPR 1AQ5AB 3JTLDEQ 1OW6BF 1AV1ACD 3JSECDS 3JSEDT 3JSEEGP 3JTLDU 1MV8BCD 3JSEETU 3JSEENR 3JSEBCR 3JTLBPU 3JSEAEQ 3JSEFQS 3JSEACS 3JTLFO 3JSEOU 3JSECST 3JSEDU 1OW6BCF 3JSEFMO 1MUUABC 3IQ6CH 1MUUABCD 3EFFAN 1MV8BD 3JSEDQT 3JSEAGP 3JSEFU 3JTLDET 1AV1CD 3JSEAQR 3JTLKPR 3JTLQTU 3JTLFQT 3JTLGQ 1MUUAB 1AV1ABC 3JSEPQ 3JTLDQR 3JSEDEU 3JSECS 3JSECT 3JSEAHQ 3JSEGO 3JSEFQT 3JTLCFT 3JSEBRT 3JTLFLO 3EFFAM 3EFFLMN 1AV1ABCD 3JTLCPQ 3JTLGPS 3JTLBOR 1MV8ABD 3JTLASU 3JSEAQS 3JTLDT 3JTLFNP 3JSEADT 3JTLALO 3JTLAR 3JSEQR 3JSEDRT 3JTLGMQ 3JTLDLT 3JSEPST 3JSEBST 3JTLCOS 3JTLRSU 3JSEAR 3JTLEMP 3JSEDIT 1QEXAB 3JTLCPT 3JTLDSU 3JSEEFU 3JSEEQS 3JTLCET 3JTLCIS 1OW6BCDF 3JTLDQS 3JTLFPS 3JSECEU 3JSEDFO 3JTLEST 3JSEEGU 3JSECIS 3JTLFMT 3JTLFQ 3JSEBFO 3JTLTU 3JSEFPS 3EFFBM 3JSEGPU 3JSEGPR 3JTLBLS 3JTLAET 1OW6BDF 3JTLGQU 3JTLANS 3JTLEPR 3JSEFMU 3JSEAFQ 3JSEAQ 3JSEEOQ 3JTLFIP 3JTLGP 3JTLPQ 3JTLDOT 3JTLGNR 1OW6ABF 1OW6ABC 3JTLAKP 3EFFCL 3JSEEQT 3JTLRS 3JSEFGO 3EFFDK 3JSEGLP 3JSEAGQ 3JSECFO 3JSEDST 3JSECRS 1OW6BD 3JTLDRU 3JTLBR 1AQ5ABC 3JTLFQS 3JSECGP 1AV1AC 3JSEEP 3JSEFP 3JSEESU 1OW6AD 1OW6BCD 3JTLAFT 3JSECDU 3EFFKL 3JSEBRU 3JSERS 3JTLFMR 2P1JAB 3JSEGQ 3JSEBQ 3JTLFNO 3JTLEFO 3JSEDGP 3JSEAEU 3JTLQR 3JSECDT 3JTLAOS 3JTLEOU 3JTLEQR 3JTLFNQ 3JTLCEO 3JSEEFO 3JTLFGO 1OW6ABCF 1AV1BC 3JSEBOR
chains in the LinkProt database with same CATH topology
1OW6BD 1OW6ABCD 1OW6ABC 1OW6ABDF 1OW6BDF 1OW6ABCF 1OW6ABF 1OW6CF 1OW6BC 1OW6BCF 1OW6BCDF 1OW6ABD 1OW6AD 1OW6BCD 1OW6BF 1OW6AB
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 1OW6 BD;  1OW6 ABCD;  1OW6 ABC;  1OW6 ABDF;  1OW6 BDF;  1OW6 ABCF;  1OW6 ABF;  1OW6 CF;  1OW6 BC;  1OW6 BCF;  1OW6 BCDF;  1OW6 ABD;  1OW6 AD;  1OW6 BCD;  1OW6 BF;  1OW6 AB; 
#chains in the LinkProt database with same CATH topology
 3JTL FGP;  3JTL FRU;  3JTL RST;  3JSE FNP;  3JSE ABR;  3JTL AFU;  3JSE DJT;  3JTL AQU;  3JTL FIO;  1MV8 AC;  3JSE COS;  1MUU BD;  3JSE TU;  3JTL BPR;  1MV8 ABCD;  3JSE FO;  3JTL DOP;  3JTL STU;  3JTL OT;  3JTL EO;  3JSE BGR;  3JTL ESU;  3JSE BPR;  3JTL BET;  3JTL DNP;  3JTL FP;  1MV8 ABC;  1AV1 BCD;  1MUU BCD;  3JSE BRS;  3EFF BN;  3JSE EPS;  3JSE CQS;  3JSE BS;  3JSE AFO;  3JSE DTU;  3JTL CHP;  3JTL BMS;  3JSE APQ;  3JTL EQT;  3JTL BPS;  3JSE ACQ;  3JTL AMR;  3JTL DPT;  3JTL NPS;  3JTL AOR;  3JTL CT;  3EFF CK;  1MFZ CD;  3JTL APQ;  1MUU CD;  3JTL ETU;  3JTL EU;  1AQ5 AC;  3JSE BDR;  1MFZ AB;  3JSE GPS;  3JTL EFT;  1OW6 ABDF;  3JTL DGO;  3JTL BFT;  1MV8 ACD;  3JSE DFT;  3JSE FJO;  3JTL DHQ;  3JTL BPT;  1OW6 CF;  3JTL GNT;  3JSE CES;  1OW6 ABD;  3JTL OU;  3JTL DFO;  3JSE ABQ;  3JTL ST;  1MUU ACD;  3JSE BCS;  3JSE PSU;  3JSE IPU;  3EFF KN;  3JTL GKO;  3JTL AP;  3JSE EFP;  3JTL CQR;  3JTL GRU;  3JSE GRS;  3JTL FQU;  1MV8 CD;  3JSE GP;  1MUU AC;  3JTL GOP;  3EFF KMN;  3JTL GIP;  3JTL AOU;  3JTL ATU;  3JTL DPR;  2DI3 AB;  1OW6 AB;  3JSE FNQ;  3JSE GOP;  3JTL CJR;  3JTL DEO;  3JSE BEU;  3JTL FMP;  3JSE BFR;  3JTL EGP;  1MV8 AB;  3JSE CSU;  3JTL BS;  3JTL CIQ;  3JSE FQR;  3JSE DOT;  3JTL FPT;  3JTL AQ;  3JSE ADQ;  1OW6 ABCD;  1AQ5 BC;  3JSE GHQ;  3JSE BDT;  3JTL DNQ;  3EFF DL;  3JTL CFP;  3JSE GST;  3JSE FPU;  3JSE BCT;  3JSE CGS;  3JSE ST;  3JSE DET;  1OW6 BC;  3JSE EOU;  3JSE GPQ;  3JTL EFP;  3JSE EU;  3JSE EO;  3JTL BSU;  3JSE BQR;  3JTL CS;  3JTL GRS;  3JTL RTU;  3JTL APT;  3JSE EPU;  1MUU ABD;  3JTL GLP;  3JTL AJO;  3JTL MQU;  3JTL BPQ;  3JSE BR;  3EFF MN;  3EFF AK;  3JSE LPR;  3JSE FNO;  3JSE FPR;  1AQ5 AB;  3JTL DEQ;  1OW6 BF;  1AV1 ACD;  3JSE CDS;  3JSE DT;  3JSE EGP;  3JTL DU;  1MV8 BCD;  3JSE ETU;  3JSE ENR;  3JSE BCR;  3JTL BPU;  3JSE AEQ;  3JSE FQS;  3JSE ACS;  3JTL FO;  3JSE OU;  3JSE CST;  3JSE DU;  1OW6 BCF;  3JSE FMO;  1MUU ABC;  3IQ6 CH;  1MUU ABCD;  3EFF AN;  1MV8 BD;  3JSE DQT;  3JSE AGP;  3JSE FU;  3JTL DET;  1AV1 CD;  3JSE AQR;  3JTL KPR;  3JTL QTU;  3JTL FQT;  3JTL GQ;  1MUU AB;  1AV1 ABC;  3JSE PQ;  3JTL DQR;  3JSE DEU;  3JSE CS;  3JSE CT;  3JSE AHQ;  3JSE GO;  3JSE FQT;  3JTL CFT;  3JSE BRT;  3JTL FLO;  3EFF AM;  3EFF LMN;  1AV1 ABCD;  3JTL CPQ;  3JTL GPS;  3JTL BOR;  1MV8 ABD;  3JTL ASU;  3JSE AQS;  3JTL DT;  3JTL FNP;  3JSE ADT;  3JTL ALO;  3JTL AR;  3JSE QR;  3JSE DRT;  3JTL GMQ;  3JTL DLT;  3JSE PST;  3JSE BST;  3JTL COS;  3JTL RSU;  3JSE AR;  3JTL EMP;  3JSE DIT;  1QEX AB;  3JTL CPT;  3JTL DSU;  3JSE EFU;  3JSE EQS;  3JTL CET;  3JTL CIS;  1OW6 BCDF;  3JTL DQS;  3JTL FPS;  3JSE CEU;  3JSE DFO;  3JTL EST;  3JSE EGU;  3JSE CIS;  3JTL FMT;  3JTL FQ;  3JSE BFO;  3JTL TU;  3JSE FPS;  3EFF BM;  3JSE GPU;  3JSE GPR;  3JTL BLS;  3JTL AET;  1OW6 BDF;  3JTL GQU;  3JTL ANS;  3JTL EPR;  3JSE FMU;  3JSE AFQ;  3JSE AQ;  3JSE EOQ;  3JTL FIP;  3JTL GP;  3JTL PQ;  3JTL DOT;  3JTL GNR;  1OW6 ABF;  1OW6 ABC;  3JTL AKP;  3EFF CL;  3JSE EQT;  3JTL RS;  3JSE FGO;  3EFF DK;  3JSE GLP;  3JSE AGQ;  3JSE CFO;  3JSE DST;  3JSE CRS;  1OW6 BD;  3JTL DRU;  3JTL BR;  1AQ5 ABC;  3JTL FQS;  3JSE CGP;  1AV1 AC;  3JSE EP;  3JSE FP;  3JSE ESU;  1OW6 AD;  1OW6 BCD;  3JTL AFT;  3JSE CDU;  3EFF KL;  3JSE BRU;  3JSE RS;  3JTL FMR;  2P1J AB;  3JSE GQ;  3JSE BQ;  3JTL FNO;  3JTL EFO;  3JSE DGP;  3JSE AEU;  3JTL QR;  3JSE CDT;  3JTL AOS;  3JTL EOU;  3JTL EQR;  3JTL FNQ;  3JTL CEO;  3JSE EFO;  3JTL FGO;  1OW6 ABCF;  1AV1 BC;  3JSE BOR; 
#chains in the LinkProt database with same CATH homology
 1OW6 BD;  1OW6 ABCD;  1OW6 ABC;  1OW6 ABDF;  1OW6 BDF;  1OW6 ABCF;  1OW6 ABF;  1OW6 CF;  1OW6 BC;  1OW6 BCF;  1OW6 BCDF;  1OW6 ABD;  1OW6 AD;  1OW6 BCD;  1OW6 BF;  1OW6 AB; 
Warning
  • This is a unique chain - no homologues found.


 
            
               
               
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling