3EFFKMN

The crystal structure of full-length kcsa in its closed conformation
Warning
  • Temporary problem with connection to RCSB web service - similar chains cannot be displayed.
  • Temporary problem with connection to RCSB web service - similar chains cannot be displayed.
  • Temporary problem with connection to RCSB web service - similar chains cannot be displayed.
Link type Probability Chain K piercings Chain M piercings Chain N piercings
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
view details
Unlink Unlink 24% +22N -161N
Interpreting sequences
Chain K Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Chain K Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Chain K Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
sequence length 139,139,139
structure length 139,139,139
publication title Crystal structure of full-length KcsA in its closed conformation.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords FAB
pdb deposition date2008-09-08
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
KMN PF07885 Ion_trans_2Ion channel
KMN PF07885 Ion_trans_2Ion channel
KMN PF07885 Ion_trans_2Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3effK02
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effM01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3effM02
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effN01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3effN02
3EFFKN 3EFFAM 3EFFLMN 3EFFAK 3EFFDL 3EFFMN 3EFFCK 3EFFBN 3EFFCL 3EFFKMN 3EFFDK 3EFFBM 3EFFKL 3EFFAN
chains in the LinkProt database with same CATH superfamily
3ETDCEF 3ETGBDE 1MV8AC 1MUUBD 1MV8ABCD 3ETDCD 1MV8ABC 1AV1BCD 1MUUBCD 3EFFBN 3ETDBDE 3ETGCF 1G6UAB 3EFFCK 1MFZCD 3ETGADF 1MUUCD 3ETDAD 3ETGADE 1AQ5AC 1MFZAB 3ETDCDF 1OW6ABDF 1OW6BD 1MV8ACD 3ETDADE 1OW6CF 1OW6ABD 1MUUACD 3ETDAC 3ETDCDE 3ETGAEF 1MV8CD 3ETDBEF 1MUUAC 3ETDADF 3EFFKMN 1OW6AB 3ETGACF 1MV8AB 3ETGABF 1OW6ABCD 1AQ5BC 3EFFDL 1OW6BC 3ETGAD 1MUUABD 3ETGBCF 3EFFMN 3ETDABF 3ETDDE 1AQ5AB 3EFFKL 1AV1ACD 3ETGBF 1MV8BCD 3ETGCEF 1OW6BCF 3ETGBCE 1MUUABC 1MUUABCD 3EFFAN 1MV8BD 3ETDBE 3ETGCDF 1AV1CD 3ETGBE 1MUUAB 1AV1ABC 3ETDACE 3ETDBCE 3ETGABE 3EFFAM 3EFFLMN 1AV1ABCD 1MV8ABD 1QEXAB 3ETDACF 3ETGABD 1OW6BCDF 3ETDAF 3EFFBM 1OW6BDF 3EFFAK 1OW6ABF 1OW6ABC 3ETGBCD 3EFFCL 3ETDABD 3EFFDK 3ETDBF 3EFFKN 1AQ5ABC 1AV1AC 3ETGDE 3ETDACD 3ETDBCF 1OW6AD 1OW6BCD 3ETGACD 1OW6BF 2P1JAB 3ETDABE 1OW6ABCF 1AV1BC
chains in the LinkProt database with same CATH topology
3ETDCEF 3EFFKN 3ETGBF 1MV8BCD 3ETGBDE 3ETGAEF 3ETGCEF 3ETDAF 3ETDBEF 1MUUAC 3EFFKMN 3ETGBCE 3ETDACF 1MUUABC 1AQ5AC 1MUUBD 3EFFAN 1MV8BD 3ETGACF 3ETDBE 3EFFDK 3ETGCDF 1MV8ABCD 3ETDCD 3EFFBN 3ETGBE 1MV8AB 1MUUAB 1MUUBCD 3ETGBCD 3ETDACE 3EFFCL 1MUUACD 3ETGABF 3ETDABD 3ETGADF 3EFFBM 3ETGAD 1MV8AC 3ETDBF 3ETDCDE 1AQ5AB 1AQ5BC 3ETDBDE 3EFFLMN 3ETGCF 3EFFDL 1MV8CD 3ETGDE 3ETDACD 3EFFCK 1MFZCD 3ETDBCE 1MUUCD 3EFFAM 3ETDAD 3ETDBCF 1MV8ABC 3ETGACD 1MV8ABD 1MFZAB 3ETDCDF 3ETGABE 2P1JAB 1MUUABD 1MV8ACD 3ETGBCF 3EFFMN 3ETDAC 3ETDABF 3ETDDE 3ETDADF 1AQ5ABC 1MUUABCD 3ETDABE 3EFFKL 3EFFAK 3ETGABD 3ETDADE 3ETGADE
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3EFF KN;  3EFF AM;  3EFF LMN;  3EFF AK;  3EFF DL;  3EFF MN;  3EFF CK;  3EFF BN;  3EFF CL;  3EFF KMN;  3EFF DK;  3EFF BM;  3EFF KL;  3EFF AN; 
#chains in the LinkProt database with same CATH topology
 3ETD CEF;  3ETG BDE;  1MV8 AC;  1MUU BD;  1MV8 ABCD;  3ETD CD;  1MV8 ABC;  1AV1 BCD;  1MUU BCD;  3EFF BN;  3ETD BDE;  3ETG CF;  1G6U AB;  3EFF CK;  1MFZ CD;  3ETG ADF;  1MUU CD;  3ETD AD;  3ETG ADE;  1AQ5 AC;  1MFZ AB;  3ETD CDF;  1OW6 ABDF;  1OW6 BD;  1MV8 ACD;  3ETD ADE;  1OW6 CF;  1OW6 ABD;  1MUU ACD;  3ETD AC;  3ETD CDE;  3ETG AEF;  1MV8 CD;  3ETD BEF;  1MUU AC;  3ETD ADF;  3EFF KMN;  1OW6 AB;  3ETG ACF;  1MV8 AB;  3ETG ABF;  1OW6 ABCD;  1AQ5 BC;  3EFF DL;  1OW6 BC;  3ETG AD;  1MUU ABD;  3ETG BCF;  3EFF MN;  3ETD ABF;  3ETD DE;  1AQ5 AB;  3EFF KL;  1AV1 ACD;  3ETG BF;  1MV8 BCD;  3ETG CEF;  1OW6 BCF;  3ETG BCE;  1MUU ABC;  1MUU ABCD;  3EFF AN;  1MV8 BD;  3ETD BE;  3ETG CDF;  1AV1 CD;  3ETG BE;  1MUU AB;  1AV1 ABC;  3ETD ACE;  3ETD BCE;  3ETG ABE;  3EFF AM;  3EFF LMN;  1AV1 ABCD;  1MV8 ABD;  1QEX AB;  3ETD ACF;  3ETG ABD;  1OW6 BCDF;  3ETD AF;  3EFF BM;  1OW6 BDF;  3EFF AK;  1OW6 ABF;  1OW6 ABC;  3ETG BCD;  3EFF CL;  3ETD ABD;  3EFF DK;  3ETD BF;  3EFF KN;  1AQ5 ABC;  1AV1 AC;  3ETG DE;  3ETD ACD;  3ETD BCF;  1OW6 AD;  1OW6 BCD;  3ETG ACD;  1OW6 BF;  2P1J AB;  3ETD ABE;  1OW6 ABCF;  1AV1 BC; 
#chains in the LinkProt database with same CATH homology
 3ETD CEF;  3EFF KN;  3ETG BF;  1MV8 BCD;  3ETG BDE;  3ETG AEF;  3ETG CEF;  3ETD AF;  3ETD BEF;  1MUU AC;  3EFF KMN;  3ETG BCE;  3ETD ACF;  1MUU ABC;  1AQ5 AC;  1MUU BD;  3EFF AN;  1MV8 BD;  3ETG ACF;  3ETD BE;  3EFF DK;  3ETG CDF;  1MV8 ABCD;  3ETD CD;  3EFF BN;  3ETG BE;  1MV8 AB;  1MUU AB;  1MUU BCD;  3ETG BCD;  3ETD ACE;  3EFF CL;  1MUU ACD;  3ETG ABF;  3ETD ABD;  3ETG ADF;  3EFF BM;  3ETG AD;  1MV8 AC;  3ETD BF;  3ETD CDE;  1AQ5 AB;  1AQ5 BC;  3ETD BDE;  3EFF LMN;  3ETG CF;  3EFF DL;  1MV8 CD;  3ETG DE;  3ETD ACD;  3EFF CK;  1MFZ CD;  3ETD BCE;  1MUU CD;  3EFF AM;  3ETD AD;  3ETD BCF;  1MV8 ABC;  3ETG ACD;  1MV8 ABD;  1MFZ AB;  3ETD CDF;  3ETG ABE;  2P1J AB;  1MUU ABD;  1MV8 ACD;  3ETG BCF;  3EFF MN;  3ETD AC;  3ETD ABF;  3ETD DE;  3ETD ADF;  1AQ5 ABC;  1MUU ABCD;  3ETD ABE;  3EFF KL;  3EFF AK;  3ETG ABD;  3ETD ADE;  3ETG ADE; 
Warning
  • This is a unique chain - no homologues found.


 
            
               
               
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling