3GXZAB

Crystal structure of cyanovirin-n complexed to oligomannose-9 (man-9)
Link type Probability Chain A piercings Chain B piercings
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
view details
Hopf.2 Hopf.2 42% -38B +86B -102B -38A +58A -71A -89A +102A
Interpreting sequences
Chain A Sequence
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE
Chain A Sequence
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE
sequence length 101,101
structure length 101,101
publication title Structures of the complexes of a potent anti-HIV protein cyanovirin-N and high mannose oligosaccharides
pubmed doi rcsb
molecule tags Antiviral protein
molecule keywords Cyanovirin-N
source organism Nostoc ellipsosporum
pdb deposition date2009-04-03
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF08881 CVNHCVNH domain
AB PF08881 CVNHCVNH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.60.10 Mainly Beta Roll HIV-inactivating Protein, Cyanovirin-n HIV-inactivating Protein,Cyanovirin-n; 3gxzA00
2.30.60.10 Mainly Beta Roll HIV-inactivating Protein, Cyanovirin-n HIV-inactivating Protein,Cyanovirin-n; 3gxzB00
1L5BAB 1J4VAB 3GXZAB 1L5EAB 3GXYAB
chains in the LinkProt database with same CATH superfamily
1L5BAB 1J4VAB 3GXZAB 1L5EAB 3GXYAB
chains in the LinkProt database with same CATH topology
1L5BAB 1J4VAB 3GXZAB 1L5EAB 3GXYAB
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 1L5B AB;  1J4V AB;  3GXZ AB;  1L5E AB;  3GXY AB; 
#chains in the LinkProt database with same CATH topology
 1L5B AB;  1J4V AB;  3GXZ AB;  1L5E AB;  3GXY AB; 
#chains in the LinkProt database with same CATH homology
 1L5B AB;  1J4V AB;  3GXZ AB;  1L5E AB;  3GXY AB; 

3CZZA 3CZZB 2RDKA 2RDKB 3LHCA 3EZMA 5K79A 5K79B 2Z21A 2Z21B 2PYSA 2PYSB 4J4CA 1LOMA 4J4GA 4J4GB 4J4GC 4J4GD 4J4FA 4J4FB 4J4FC 4J4FD 4J4DA 4J4DB 4J4DC 4J4DD 1L5BA 1L5BB 3GXYA 3GXYB 4J4EA 4J4EB 4J4EC 4J4ED 4J4EE 4J4EF 3GXZB 2RP3A 1N02A 1L5EA 1L5EB 1J4VA 1J4VB 1IIYA 2EZMA 2EZNA 3CZZA 3CZZB 2RDKA 2RDKB 3LHCA 3EZMA 5K79A 5K79B 2Z21A 2Z21B 2PYSA 2PYSB 4J4CA 1LOMA 4J4GA 4J4GB 4J4GC 4J4GD 4J4FA 4J4FB 4J4FC 4J4FD 4J4DA 4J4DB 4J4DC 4J4DD 1L5BA 1L5BB 3GXYA 3GXYB 4J4EA 4J4EB 4J4EC 4J4ED 4J4EE 4J4EF 3GXZA 2RP3A 1N02A 1L5EA 1L5EB 1J4VA 1J4VB 1IIYA 2EZMA 2EZNA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3CZZ_A;  3CZZ_B;  2RDK_A;  2RDK_B;  3LHC_A;  3EZM_A;  5K79_A;  5K79_B;  2Z21_A;  2Z21_B;  2PYS_A;  2PYS_B;  4J4C_A;  1LOM_A;  4J4G_A;  4J4G_B;  4J4G_C;  4J4G_D;  4J4F_A;  4J4F_B;  4J4F_C;  4J4F_D;  4J4D_A;  4J4D_B;  4J4D_C;  4J4D_D;  1L5B_A;  1L5B_B;  3GXY_A;  3GXY_B;  4J4E_A;  4J4E_B;  4J4E_C;  4J4E_D;  4J4E_E;  4J4E_F;  3GXZ_B;  2RP3_A;  1N02_A;  1L5E_A;  1L5E_B;  1J4V_A;  1J4V_B;  1IIY_A;  2EZM_A;  2EZN_A;  3CZZ_A;  3CZZ_B;  2RDK_A;  2RDK_B;  3LHC_A;  3EZM_A;  5K79_A;  5K79_B;  2Z21_A;  2Z21_B;  2PYS_A;  2PYS_B;  4J4C_A;  1LOM_A;  4J4G_A;  4J4G_B;  4J4G_C;  4J4G_D;  4J4F_A;  4J4F_B;  4J4F_C;  4J4F_D;  4J4D_A;  4J4D_B;  4J4D_C;  4J4D_D;  1L5B_A;  1L5B_B;  3GXY_A;  3GXY_B;  4J4E_A;  4J4E_B;  4J4E_C;  4J4E_D;  4J4E_E;  4J4E_F;  3GXZ_A;  2RP3_A;  1N02_A;  1L5E_A;  1L5E_B;  1J4V_A;  1J4V_B;  1IIY_A;  2EZM_A;  2EZN_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling