3EH0ABC

Crystal structure of lpxd from escherichia coli
Link type Probability Chain A piercings Chain B piercings Chain C piercings
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
view details
Other Other 28% -330B -306C +182A -195A -341A -322C +178A -201A +341A +341A +181B -200B +273B +290B
Interpreting sequences
Chain A Sequence
MASIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD
Chain A Sequence
MASIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD
Chain A Sequence
MASIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD
sequence length 341,341,341
structure length 341,341,341
publication title Crystal structure and acyl chain selectivity of Escherichia coli LpxD, the N-acyltransferase of lipid A biosynthesis
pubmed doi rcsb
molecule tags Transferase
molecule keywords UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
source organism Escherichia coli
ec nomenclature ec 2.3.1.19: Phosphate butyryltransferase.
ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
ec 2.3.1.19: Phosphate butyryltransferase.
ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
ec 2.3.1.19: Phosphate butyryltransferase.
ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date2008-09-11
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABC PF00132 HexapepBacterial transferase hexapeptide (six repeats)
ABC PF04613 LpxDUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
ABC PF14602 Hexapep_2Hexapeptide repeat of succinyl-transferase
ABC PF00132 HexapepBacterial transferase hexapeptide (six repeats)
ABC PF04613 LpxDUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
ABC PF14602 Hexapep_2Hexapeptide repeat of succinyl-transferase
ABC PF00132 HexapepBacterial transferase hexapeptide (six repeats)
ABC PF04613 LpxDUDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
ABC PF14602 Hexapep_2Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3eh0A02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3eh0B02
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3eh0C02
3GOSAB 3GOSAC 3GOSABC 3EH0BC 3EH0AC 3GOSBC 3EH0ABC 3EH0AB
chains in the LinkProt database with same CATH superfamily
3GOSAB 3GOSAC 3GOSABC 3EH0BC 3EH0AC 3GOSBC 3EH0ABC 3EH0AB
chains in the LinkProt database with same CATH topology
3GOSAB 3GOSAC 3GOSABC 3EH0BC 3EH0AC 3GOSBC 3EH0ABC 3EH0AB
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3GOS AB;  3GOS AC;  3GOS ABC;  3EH0 BC;  3EH0 AC;  3GOS BC;  3EH0 ABC;  3EH0 AB; 
#chains in the LinkProt database with same CATH topology
 3GOS AB;  3GOS AC;  3GOS ABC;  3EH0 BC;  3EH0 AC;  3GOS BC;  3EH0 ABC;  3EH0 AB; 
#chains in the LinkProt database with same CATH homology
 3GOS AB;  3GOS AC;  3GOS ABC;  3EH0 BC;  3EH0 AC;  3GOS BC;  3EH0 ABC;  3EH0 AB; 

3PMOA 6P89A 6P89B 6P89C 6P83A 6P83B 6P83C 6P84A 6P84B 6P84C 6P88A 6P88B 6P88C 6P86A 6P86B 6P86C 6P8AA 6P8AB 6P8AC 6P85A 6P85B 6P85C 6P87A 6P87B 6P87C 6P8BA 6P8BB 6P8BC 4IHFA 4IHFB 4IHFC 4IHFD 4IHFE 4IHFF 4IHHA 4IHHB 4IHHC 4IHHD 4IHHE 4IHHF 2IU8A 2IU8B 2IU8C 3EH0B 3EH0C 2IUAA 2IUAB 2IUAC 4IHGA 4IHGB 4IHGC 4IHGD 4IHGE 4IHGF 4E79A 4E79B 4E79C 4E75A 4E75B 4E75C 4E75D 4E75E 4E75F 2IU9A 2IU9B 2IU9C 3PMOA 6P89A 6P89B 6P89C 6P83A 6P83B 6P83C 6P84A 6P84B 6P84C 6P88A 6P88B 6P88C 6P86A 6P86B 6P86C 6P8AA 6P8AB 6P8AC 6P85A 6P85B 6P85C 6P87A 6P87B 6P87C 6P8BA 6P8BB 6P8BC 4IHFA 4IHFB 4IHFC 4IHFD 4IHFE 4IHFF 4IHHA 4IHHB 4IHHC 4IHHD 4IHHE 4IHHF 2IU8A 2IU8B 2IU8C 3EH0A 3EH0C 2IUAA 2IUAB 2IUAC 4IHGA 4IHGB 4IHGC 4IHGD 4IHGE 4IHGF 4E79A 4E79B 4E79C 4E75A 4E75B 4E75C 4E75D 4E75E 4E75F 2IU9A 2IU9B 2IU9C 3PMOA 6P89A 6P89B 6P89C 6P83A 6P83B 6P83C 6P84A 6P84B 6P84C 6P88A 6P88B 6P88C 6P86A 6P86B 6P86C 6P8AA 6P8AB 6P8AC 6P85A 6P85B 6P85C 6P87A 6P87B 6P87C 6P8BA 6P8BB 6P8BC 4IHFA 4IHFB 4IHFC 4IHFD 4IHFE 4IHFF 4IHHA 4IHHB 4IHHC 4IHHD 4IHHE 4IHHF 2IU8A 2IU8B 2IU8C 3EH0A 3EH0B 2IUAA 2IUAB 2IUAC 4IHGA 4IHGB 4IHGC 4IHGD 4IHGE 4IHGF 4E79A 4E79B 4E79C 4E75A 4E75B 4E75C 4E75D 4E75E 4E75F 2IU9A 2IU9B 2IU9C
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3PMO_A;  6P89_A;  6P89_B;  6P89_C;  6P83_A;  6P83_B;  6P83_C;  6P84_A;  6P84_B;  6P84_C;  6P88_A;  6P88_B;  6P88_C;  6P86_A;  6P86_B;  6P86_C;  6P8A_A;  6P8A_B;  6P8A_C;  6P85_A;  6P85_B;  6P85_C;  6P87_A;  6P87_B;  6P87_C;  6P8B_A;  6P8B_B;  6P8B_C;  4IHF_A;  4IHF_B;  4IHF_C;  4IHF_D;  4IHF_E;  4IHF_F;  4IHH_A;  4IHH_B;  4IHH_C;  4IHH_D;  4IHH_E;  4IHH_F;  2IU8_A;  2IU8_B;  2IU8_C;  3EH0_B;  3EH0_C;  2IUA_A;  2IUA_B;  2IUA_C;  4IHG_A;  4IHG_B;  4IHG_C;  4IHG_D;  4IHG_E;  4IHG_F;  4E79_A;  4E79_B;  4E79_C;  4E75_A;  4E75_B;  4E75_C;  4E75_D;  4E75_E;  4E75_F;  2IU9_A;  2IU9_B;  2IU9_C;  3PMO_A;  6P89_A;  6P89_B;  6P89_C;  6P83_A;  6P83_B;  6P83_C;  6P84_A;  6P84_B;  6P84_C;  6P88_A;  6P88_B;  6P88_C;  6P86_A;  6P86_B;  6P86_C;  6P8A_A;  6P8A_B;  6P8A_C;  6P85_A;  6P85_B;  6P85_C;  6P87_A;  6P87_B;  6P87_C;  6P8B_A;  6P8B_B;  6P8B_C;  4IHF_A;  4IHF_B;  4IHF_C;  4IHF_D;  4IHF_E;  4IHF_F;  4IHH_A;  4IHH_B;  4IHH_C;  4IHH_D;  4IHH_E;  4IHH_F;  2IU8_A;  2IU8_B;  2IU8_C;  3EH0_A;  3EH0_C;  2IUA_A;  2IUA_B;  2IUA_C;  4IHG_A;  4IHG_B;  4IHG_C;  4IHG_D;  4IHG_E;  4IHG_F;  4E79_A;  4E79_B;  4E79_C;  4E75_A;  4E75_B;  4E75_C;  4E75_D;  4E75_E;  4E75_F;  2IU9_A;  2IU9_B;  2IU9_C;  3PMO_A;  6P89_A;  6P89_B;  6P89_C;  6P83_A;  6P83_B;  6P83_C;  6P84_A;  6P84_B;  6P84_C;  6P88_A;  6P88_B;  6P88_C;  6P86_A;  6P86_B;  6P86_C;  6P8A_A;  6P8A_B;  6P8A_C;  6P85_A;  6P85_B;  6P85_C;  6P87_A;  6P87_B;  6P87_C;  6P8B_A;  6P8B_B;  6P8B_C;  4IHF_A;  4IHF_B;  4IHF_C;  4IHF_D;  4IHF_E;  4IHF_F;  4IHH_A;  4IHH_B;  4IHH_C;  4IHH_D;  4IHH_E;  4IHH_F;  2IU8_A;  2IU8_B;  2IU8_C;  3EH0_A;  3EH0_B;  2IUA_A;  2IUA_B;  2IUA_C;  4IHG_A;  4IHG_B;  4IHG_C;  4IHG_D;  4IHG_E;  4IHG_F;  4E79_A;  4E79_B;  4E79_C;  4E75_A;  4E75_B;  4E75_C;  4E75_D;  4E75_E;  4E75_F;  2IU9_A;  2IU9_B;  2IU9_C; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling