| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
| view details |
|
Hopf.1 | 53% | +112B | +79A -90A +141A | ||||||||
Chain A Sequence |
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAY------THEQHLRKSEAQAKKEKLNIWS |
Chain A Sequence |
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAY------THEQHLRKSEAQAKKEKLNIWS |
| sequence length | 129,129 |
| structure length | 129,129 |
| publication title |
One-step evolution of a dimer from a monomeric protein.
pubmed doi rcsb |
| molecule tags | Hydrolase |
| molecule keywords | STAPHYLOCOCCAL NUCLEASE DIMER |
| source organism | Staphylococcus aureus |
| missing residues | A: 113-120 B: 113-120 |
| ec nomenclature |
ec 3.1.31.1: Micrococcal nuclease. ec 3.1.31.1: Micrococcal nuclease. |
| pdb deposition date | 1996-08-23 |
| LinkProt deposition date | 2016-10-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00565 | SNase | Staphylococcal nuclease homologue |
| AB | PF00565 | SNase | Staphylococcal nuclease homologue |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | ||
| Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | OB fold (Dihydrolipoamide Acetyltransferase, E2P) |
#chains in the LinkProt database with same CATH superfamily 1SND AB; #chains in the LinkProt database with same CATH topology 1ASY AB; 1Y8P AB; 1Y8N AB; 1ASZ AB; 1Y8O AB; 1SND AB; #chains in the LinkProt database with same CATH homology 1Y8P AB; 1Y8N AB; 1Y8O AB; 1SND AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
