Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A | |||||||||
view details | Hopf.2 | 52% | -139B +153B -174B -189B +202B | -91A |
Chain A Sequence |
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE |
Chain A Sequence |
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE |
sequence length | 101,101 |
structure length | 101,101 |
publication title |
The domain-swapped dimer of cyanovirin-N is in a metastable folded state: reconciliation of X-ray and NMR structures.
pubmed doi rcsb |
molecule tags | Antiviral protein |
molecule keywords | Cyanovirin-N |
source organism | Nostoc ellipsosporum |
pdb deposition date | 2002-03-06 |
LinkProt deposition date | 2016-10-21 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
AB | PF08881 | CVNH | CVNH domain |
AB | PF08881 | CVNH | CVNH domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Roll | HIV-inactivating Protein, Cyanovirin-n | HIV-inactivating Protein,Cyanovirin-n; | ||
Mainly Beta | Roll | HIV-inactivating Protein, Cyanovirin-n | HIV-inactivating Protein,Cyanovirin-n; |
#chains in the LinkProt database with same CATH superfamily 1L5B AB; 1J4V AB; 3GXZ AB; 1L5E AB; 3GXY AB; #chains in the LinkProt database with same CATH topology 1L5B AB; 1J4V AB; 3GXZ AB; 1L5E AB; 3GXY AB; #chains in the LinkProt database with same CATH homology 1L5B AB; 1J4V AB; 3GXZ AB; 1L5E AB; 3GXY AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...