| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
| view details |
|
Hopf.2 | 39% | -38B +59B -69B +86B -102B | -38A -91A +102A | ||||||||
Chain A Sequence |
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE |
Chain A Sequence |
LGKFSQTCYNSAIQGSVLTSTCERTNGGYNTSSIDLNSVIENVDGSLKWQPSNFIETCRNTQLAGSSELAAECKTRAQQFVSTKINLDDHIANIDGTLKYE |
| sequence length | 101,101 |
| structure length | 101,101 |
| publication title |
The domain-swapped dimer of cyanovirin-N is in a metastable folded state: reconciliation of X-ray and NMR structures.
pubmed doi rcsb |
| molecule tags | Antiviral protein |
| molecule keywords | cyanovirin-N |
| source organism | Nostoc ellipsosporum |
| pdb deposition date | 2002-03-06 |
| LinkProt deposition date | 2016-10-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF08881 | CVNH | CVNH domain |
| AB | PF08881 | CVNH | CVNH domain |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Roll | HIV-inactivating Protein, Cyanovirin-n | HIV-inactivating Protein,Cyanovirin-n; | ||
| Mainly Beta | Roll | HIV-inactivating Protein, Cyanovirin-n | HIV-inactivating Protein,Cyanovirin-n; |
#chains in the LinkProt database with same CATH superfamily 1L5B AB; 1J4V AB; 3GXZ AB; 1L5E AB; 3GXY AB; #chains in the LinkProt database with same CATH topology 1L5B AB; 1J4V AB; 3GXZ AB; 1L5E AB; 3GXY AB; #chains in the LinkProt database with same CATH homology 1L5B AB; 1J4V AB; 3GXZ AB; 1L5E AB; 3GXY AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
