3JVYAB

Hiv-1 protease mutant g86a with darunavir
Link type Probability Chain A piercings Chain B piercings
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
view details
Unlink Unlink 39% -186B +200B
Interpreting sequences
Chain A Sequence
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIARNLLTQIGATLNF
Chain A Sequence
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIARNLLTQIGATLNF
sequence length 99,99
structure length 99,99
publication title Highly conserved glycine 86 and arginine 87 residues contribute differently to the structure and activity of the mature HIV-1 protease
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Gag-Pol polyprotein
source organism Human immunodeficiency virus type 1 (bru isolate)
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
ec 2.7.7.7: DNA-directed DNA polymerase.
ec 3.1.13.2: Exoribonuclease H.
ec 3.1.26.13: Retroviral ribonuclease H.
ec 3.4.23.16: HIV-1 retropepsin.
ec 2.7.7.49: RNA-directed DNA polymerase.
ec 2.7.7.7: DNA-directed DNA polymerase.
ec 3.1.13.2: Exoribonuclease H.
ec 3.1.26.13: Retroviral ribonuclease H.
ec 3.4.23.16: HIV-1 retropepsin.
pdb deposition date2009-09-17
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF00077 RVPRetroviral aspartyl protease
AB PF00077 RVPRetroviral aspartyl protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.70.10 Mainly Beta Beta Barrel Cathepsin D, subunit A; domain 1 Acid Proteases 3jvyA00
2.40.70.10 Mainly Beta Beta Barrel Cathepsin D, subunit A; domain 1 Acid Proteases 3jvyB00
3HAUAB 3EKXAB 3GGVDGH 1A8KBDE 3FV3EFN 3GGACD 3EL1AB 3FV3BDJ 3GGXCDG 1A94BDE 3GGXCGH 3EM4UV 3FV3AGI 3FV3CHK 3EM4AU 3GGXAB 3GGVABH 3GGXEF 3DOXAQ 3GGXACD 3FV3DL 3GGVABE 1A8KDE 3GGXBCD 3JW2AB 3ECGAB 3FV3BEM 3EKPCD 1A30AC 3GGVAB 3EKTABD 3GGACGH 3GI0AC 3FV3HNP 3FV3ADL 3GI5AB 3GGAABD 3GGXFGH 3IXOAB 1AIDAB 3GGABCD 1A94DE 3EM4AB 3HAWAB 3GGXABG 3EKQAB 3FV3BGJ 3GGVEFH 3GGXABH 3GGVFGH 3FV3CIK 3GGVCDE 3HDKAB 3FV3DEF 3GGXEFH 3GGVGH 3FV3GO 3GGXDEF 3DOXAPQ 3GGXCEF 3GGACDG 3FV3CEF 3GGAAGH 3FV3CK 3FV3DEL 3FV3EFH 3GGXBEF 3GGXCDF 3GGVAGH 3EM4BUV 3GGAAB 3EKTAB 1A94ABD 3FV3CGO 3FV3BJL 3FV3EJM 3EM6AB 3FV3DLO 3FV3FHN 3GGVABD 3GGAACD 3EKPBCD 3FV3CFK 3FV3ABJ 3GGXAEF 3FV3BDL 3GGXCDE 3FV3EHP 3FV3EMN 3GGXEGH 3GGVBCD 3GGVDEF 3JVYAB 3GGVABG 3GI6AB 3FV3GHO 3EC0AB 3FV3ACK 3FV3FIN 3EKPACD 3GGXCDH 3GGVGHI 3GGXABF 3GGXDGH 3GGVEFG 3GGACDH 3FV3DFL 3EL9AB 1AJVAB 3FV3BJ 3EL4AB 3FV3FGN 3EM3AB 3FV3BCJ 3EKYAB 1A8KADE 3DOXAP 3FV3EM 3FV3BHJ 3GGXAGH 3GGXABE 3GGXBGH 3GGXGH 1A8KAB 3FV3CDK 3FV3AGO 3GGUAB 3HBOAB 3FV3AI 1A94AB 3GGAGH 3GGVCEF 3FV3DEM 3GGVCDG 3EMYAB 3FV3BHP 3FV3AEI 3H5BAB 3GGVEF 3JVWAB 3EKVAB 3GI4AB 3GGVEGH 3FV3GHP 3FV3BFJ 3GGVCD 3FV3BJO 3EKTBCD 3FV3CKN 3GGABGH 3GGVAEF 3FV3ADI 3GGVABC 3DK1AB 3EM4ABU 3FX5AB 3EKPABC 3FV3CHP 3EL0AB 3GGAABG 3FV3AEM 3EM4ABV 3EKWAB 3FV3AFI 3GGADGH 3FV3DHL 3GGVABI 1A94ADE 3GGVABF 3FV3CEK 3GGVCDH 3FV3EGO 3GGVCDI 3EKPABD 3FV3EF 3GGAABH 1A30AB 1A8KABE 3FV3DGO 3EKTABC 3GGVACD 3FV3AFN 3FV3FGO 3FV3HP 3FV3BCK 3FV3AHI 3GGVCGH 3FV3ACI 3FV3CFN 3FV3CKP 1AJXAB 3EKPAB 3GGXABD 1A30ABC 3GGVEFI 1AAQAB 3EKTCD 3FV3BGO 3FV3DGL 3FV3DFN 1A30BC 3FV3ABI 3FV3AHP 1A9MAB 3FV3CEM 3GGVCDF 3EM4AUV 3GGVBGH 1A8KABD 3FV3BDG 3GGAABC 3FV3EGM 3FV3EHM 3GGVBEF 1A8GAB 3GGXABC 3EKTACD 3FV3ABG 3GGXEFG 3GGXCD 3EL5AB 1A94ABE 3FV3EFM 3FV3FN
chains in the LinkProt database with same CATH superfamily
3HAUAB 3EKXAB 3GGVDGH 1A8KBDE 3FV3EFN 3GGACD 3EL1AB 3FV3BDJ 3GGXCDG 1A94BDE 3GGXCGH 3EM4UV 3FV3AGI 3FV3CHK 3EM4AU 3GGXAB 3GGVABH 3GGXEF 3DOXAQ 3GGXACD 3FV3DL 3GGVABE 1A8KDE 3GGXBCD 3JW2AB 3ECGAB 3FV3BEM 3EKPCD 1A30AC 3GGVAB 3EKTABD 3GGACGH 3GI0AC 3FV3HNP 3FV3ADL 3GI5AB 3GGAABD 3GGXFGH 3IXOAB 1AIDAB 3GGABCD 1A94DE 3EM4AB 3HAWAB 3GGXABG 3EKQAB 3FV3BGJ 3GGVEFH 3GGXABH 3GGVFGH 3FV3CIK 3GGVCDE 3HDKAB 3FV3DEF 3GGXEFH 3GGVGH 3FV3GO 3GGXDEF 3DOXAPQ 3GGXCEF 3GGACDG 3FV3CEF 3GGAAGH 3FV3CK 3FV3DEL 3FV3EFH 3GGXBEF 3GGXCDF 3GGVAGH 3EM4BUV 3GGAAB 3EKTAB 1A94ABD 3FV3CGO 3FV3BJL 3FV3EJM 3EM6AB 3FV3DLO 3FV3FHN 3GGVABD 3GGAACD 3EKPBCD 3FV3CFK 3FV3ABJ 3GGXAEF 3FV3BDL 3GGXCDE 3FV3EHP 3FV3EMN 3GGXEGH 3GGVBCD 3GGVDEF 3JVYAB 3GGVABG 3GI6AB 3FV3GHO 3EC0AB 3FV3ACK 3FV3FIN 3EKPACD 3GGXCDH 3GGVGHI 3GGXABF 3GGXDGH 3GGVEFG 3GGACDH 3FV3DFL 3EL9AB 1AJVAB 3FV3BJ 3EL4AB 3FV3FGN 3EM3AB 3FV3BCJ 3EKYAB 1A8KADE 3DOXAP 3FV3EM 3FV3BHJ 3GGXAGH 3GGXABE 3GGXBGH 3GGXGH 1A8KAB 3FV3CDK 3FV3AGO 3GGUAB 3HBOAB 3FV3AI 1A94AB 3GGAGH 3GGVCEF 3FV3DEM 3GGVCDG 3EMYAB 3FV3BHP 3FV3AEI 3H5BAB 3GGVEF 3JVWAB 3EKVAB 3GI4AB 3GGVEGH 3FV3GHP 3FV3BFJ 3GGVCD 3FV3BJO 3EKTBCD 3FV3CKN 3GGABGH 3GGVAEF 3FV3ADI 3GGVABC 3DK1AB 3EM4ABU 3FX5AB 3EKPABC 3FV3CHP 3EL0AB 3GGAABG 3FV3AEM 3EM4ABV 3EKWAB 3FV3AFI 3GGADGH 3FV3DHL 3GGVABI 1A94ADE 3GGVABF 3FV3CEK 3GGVCDH 3FV3EGO 3GGVCDI 3EKPABD 3FV3EF 3GGAABH 1A30AB 1A8KABE 3FV3DGO 3EKTABC 3GGVACD 3FV3AFN 3FV3FGO 3FV3HP 3FV3BCK 3FV3AHI 3GGVCGH 3FV3ACI 3FV3CFN 3FV3CKP 1AJXAB 3EKPAB 3GGXABD 1A30ABC 3GGVEFI 1AAQAB 3EKTCD 3FV3BGO 3FV3DGL 3FV3DFN 1A30BC 3FV3ABI 3FV3AHP 1A9MAB 3FV3CEM 3GGVCDF 3EM4AUV 3GGVBGH 1A8KABD 3FV3BDG 3GGAABC 3FV3EGM 3FV3EHM 3GGVBEF 1A8GAB 3GGXABC 3EKTACD 3FV3ABG 3GGXEFG 3GGXCD 3EL5AB 1A94ABE 3FV3EFM 3FV3FN
chains in the LinkProt database with same CATH topology
3HAUAB 3EKXAB 3GGVDGH 1A8KBDE 3FV3EFN 3GGACD 3EL1AB 3FV3BDJ 3GGXCDG 1A94BDE 3GGXCGH 3EM4UV 3FV3AGI 3FV3CHK 3EM4AU 3GGXAB 3GGVABH 3GGXEF 3DOXAQ 3GGXACD 3FV3DL 3GGVABE 1A8KDE 3GGXBCD 3JW2AB 3ECGAB 3FV3BEM 3EKPCD 1A30AC 3GGVAB 3EKTABD 3GGACGH 3GI0AC 3FV3HNP 3FV3ADL 3GI5AB 3GGAABD 3GGXFGH 3IXOAB 1AIDAB 3GGABCD 1A94DE 3EM4AB 3HAWAB 3GGXABG 3EKQAB 3FV3BGJ 3GGVEFH 3GGXABH 3GGVFGH 3FV3CIK 3GGVCDE 3HDKAB 3FV3DEF 3GGXEFH 3GGVGH 3FV3GO 3GGXDEF 3DOXAPQ 3GGXCEF 3GGACDG 3FV3CEF 3GGAAGH 3FV3CK 3FV3DEL 3FV3EFH 3GGXBEF 3GGXCDF 3GGVAGH 3EM4BUV 3GGAAB 3EKTAB 1A94ABD 3FV3CGO 3FV3BJL 3FV3EJM 3EM6AB 3FV3DLO 3FV3FHN 3GGVABD 3GGAACD 3EKPBCD 3FV3CFK 3FV3ABJ 3GGXAEF 3FV3BDL 3GGXCDE 3FV3EHP 3FV3EMN 3GGXEGH 3GGVBCD 3GGVDEF 3JVYAB 3GGVABG 3GI6AB 3FV3GHO 3EC0AB 3FV3ACK 3FV3FIN 3EKPACD 3GGXCDH 3GGVGHI 3GGXABF 3GGXDGH 3GGVEFG 3GGACDH 3FV3DFL 3EL9AB 1AJVAB 3FV3BJ 3EL4AB 3FV3FGN 3EM3AB 3FV3BCJ 3EKYAB 1A8KADE 3DOXAP 3FV3EM 3FV3BHJ 3GGXAGH 3GGXABE 3GGXBGH 3GGXGH 1A8KAB 3FV3CDK 3FV3AGO 3GGUAB 3HBOAB 3FV3AI 1A94AB 3GGAGH 3GGVCEF 3FV3DEM 3GGVCDG 3EMYAB 3FV3BHP 3FV3AEI 3H5BAB 3GGVEF 3JVWAB 3EKVAB 3GI4AB 3GGVEGH 3FV3GHP 3FV3BFJ 3GGVCD 3FV3BJO 3EKTBCD 3FV3CKN 3GGABGH 3GGVAEF 3FV3ADI 3GGVABC 3DK1AB 3EM4ABU 3FX5AB 3EKPABC 3FV3CHP 3EL0AB 3GGAABG 3FV3AEM 3EM4ABV 3EKWAB 3FV3AFI 3GGADGH 3FV3DHL 3GGVABI 1A94ADE 3GGVABF 3FV3CEK 3GGVCDH 3FV3EGO 3GGVCDI 3EKPABD 3FV3EF 3GGAABH 1A30AB 1A8KABE 3FV3DGO 3EKTABC 3GGVACD 3FV3AFN 3FV3FGO 3FV3HP 3FV3BCK 3FV3AHI 3GGVCGH 3FV3ACI 3FV3CFN 3FV3CKP 1AJXAB 3EKPAB 3GGXABD 1A30ABC 3GGVEFI 1AAQAB 3EKTCD 3FV3BGO 3FV3DGL 3FV3DFN 1A30BC 3FV3ABI 3FV3AHP 1A9MAB 3FV3CEM 3GGVCDF 3EM4AUV 3GGVBGH 1A8KABD 3FV3BDG 3GGAABC 3FV3EGM 3FV3EHM 3GGVBEF 1A8GAB 3GGXABC 3EKTACD 3FV3ABG 3GGXEFG 3GGXCD 3EL5AB 1A94ABE 3FV3EFM 3FV3FN
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3HAU AB;  3EKX AB;  3GGV DGH;  1A8K BDE;  3FV3 EFN;  3GGA CD;  3EL1 AB;  3FV3 BDJ;  3GGX CDG;  1A94 BDE;  3GGX CGH;  3EM4 UV;  3FV3 AGI;  3FV3 CHK;  3EM4 AU;  3GGX AB;  3GGV ABH;  3GGX EF;  3DOX AQ;  3GGX ACD;  3FV3 DL;  3GGV ABE;  1A8K DE;  3GGX BCD;  3JW2 AB;  3ECG AB;  3FV3 BEM;  3EKP CD;  1A30 AC;  3GGV AB;  3EKT ABD;  3GGA CGH;  3GI0 AC;  3FV3 HNP;  3FV3 ADL;  3GI5 AB;  3GGA ABD;  3GGX FGH;  3IXO AB;  1AID AB;  3GGA BCD;  1A94 DE;  3EM4 AB;  3HAW AB;  3GGX ABG;  3EKQ AB;  3FV3 BGJ;  3GGV EFH;  3GGX ABH;  3GGV FGH;  3FV3 CIK;  3GGV CDE;  3HDK AB;  3FV3 DEF;  3GGX EFH;  3GGV GH;  3FV3 GO;  3GGX DEF;  3DOX APQ;  3GGX CEF;  3GGA CDG;  3FV3 CEF;  3GGA AGH;  3FV3 CK;  3FV3 DEL;  3FV3 EFH;  3GGX BEF;  3GGX CDF;  3GGV AGH;  3EM4 BUV;  3GGA AB;  3EKT AB;  1A94 ABD;  3FV3 CGO;  3FV3 BJL;  3FV3 EJM;  3EM6 AB;  3FV3 DLO;  3FV3 FHN;  3GGV ABD;  3GGA ACD;  3EKP BCD;  3FV3 CFK;  3FV3 ABJ;  3GGX AEF;  3FV3 BDL;  3GGX CDE;  3FV3 EHP;  3FV3 EMN;  3GGX EGH;  3GGV BCD;  3GGV DEF;  3JVY AB;  3GGV ABG;  3GI6 AB;  3FV3 GHO;  3EC0 AB;  3FV3 ACK;  3FV3 FIN;  3EKP ACD;  3GGX CDH;  3GGV GHI;  3GGX ABF;  3GGX DGH;  3GGV EFG;  3GGA CDH;  3FV3 DFL;  3EL9 AB;  1AJV AB;  3FV3 BJ;  3EL4 AB;  3FV3 FGN;  3EM3 AB;  3FV3 BCJ;  3EKY AB;  1A8K ADE;  3DOX AP;  3FV3 EM;  3FV3 BHJ;  3GGX AGH;  3GGX ABE;  3GGX BGH;  3GGX GH;  1A8K AB;  3FV3 CDK;  3FV3 AGO;  3GGU AB;  3HBO AB;  3FV3 AI;  1A94 AB;  3GGA GH;  3GGV CEF;  3FV3 DEM;  3GGV CDG;  3EMY AB;  3FV3 BHP;  3FV3 AEI;  3H5B AB;  3GGV EF;  3JVW AB;  3EKV AB;  3GI4 AB;  3GGV EGH;  3FV3 GHP;  3FV3 BFJ;  3GGV CD;  3FV3 BJO;  3EKT BCD;  3FV3 CKN;  3GGA BGH;  3GGV AEF;  3FV3 ADI;  3GGV ABC;  3DK1 AB;  3EM4 ABU;  3FX5 AB;  3EKP ABC;  3FV3 CHP;  3EL0 AB;  3GGA ABG;  3FV3 AEM;  3EM4 ABV;  3EKW AB;  3FV3 AFI;  3GGA DGH;  3FV3 DHL;  3GGV ABI;  1A94 ADE;  3GGV ABF;  3FV3 CEK;  3GGV CDH;  3FV3 EGO;  3GGV CDI;  3EKP ABD;  3FV3 EF;  3GGA ABH;  1A30 AB;  1A8K ABE;  3FV3 DGO;  3EKT ABC;  3GGV ACD;  3FV3 AFN;  3FV3 FGO;  3FV3 HP;  3FV3 BCK;  3FV3 AHI;  3GGV CGH;  3FV3 ACI;  3FV3 CFN;  3FV3 CKP;  1AJX AB;  3EKP AB;  3GGX ABD;  1A30 ABC;  3GGV EFI;  1AAQ AB;  3EKT CD;  3FV3 BGO;  3FV3 DGL;  3FV3 DFN;  1A30 BC;  3FV3 ABI;  3FV3 AHP;  1A9M AB;  3FV3 CEM;  3GGV CDF;  3EM4 AUV;  3GGV BGH;  1A8K ABD;  3FV3 BDG;  3GGA ABC;  3FV3 EGM;  3FV3 EHM;  3GGV BEF;  1A8G AB;  3GGX ABC;  3EKT ACD;  3FV3 ABG;  3GGX EFG;  3GGX CD;  3EL5 AB;  1A94 ABE;  3FV3 EFM;  3FV3 FN; 
#chains in the LinkProt database with same CATH topology
 3HAU AB;  3EKX AB;  3GGV DGH;  1A8K BDE;  3FV3 EFN;  3GGA CD;  3EL1 AB;  3FV3 BDJ;  3GGX CDG;  1A94 BDE;  3GGX CGH;  3EM4 UV;  3FV3 AGI;  3FV3 CHK;  3EM4 AU;  3GGX AB;  3GGV ABH;  3GGX EF;  3DOX AQ;  3GGX ACD;  3FV3 DL;  3GGV ABE;  1A8K DE;  3GGX BCD;  3JW2 AB;  3ECG AB;  3FV3 BEM;  3EKP CD;  1A30 AC;  3GGV AB;  3EKT ABD;  3GGA CGH;  3GI0 AC;  3FV3 HNP;  3FV3 ADL;  3GI5 AB;  3GGA ABD;  3GGX FGH;  3IXO AB;  1AID AB;  3GGA BCD;  1A94 DE;  3EM4 AB;  3HAW AB;  3GGX ABG;  3EKQ AB;  3FV3 BGJ;  3GGV EFH;  3GGX ABH;  3GGV FGH;  3FV3 CIK;  3GGV CDE;  3HDK AB;  3FV3 DEF;  3GGX EFH;  3GGV GH;  3FV3 GO;  3GGX DEF;  3DOX APQ;  3GGX CEF;  3GGA CDG;  3FV3 CEF;  3GGA AGH;  3FV3 CK;  3FV3 DEL;  3FV3 EFH;  3GGX BEF;  3GGX CDF;  3GGV AGH;  3EM4 BUV;  3GGA AB;  3EKT AB;  1A94 ABD;  3FV3 CGO;  3FV3 BJL;  3FV3 EJM;  3EM6 AB;  3FV3 DLO;  3FV3 FHN;  3GGV ABD;  3GGA ACD;  3EKP BCD;  3FV3 CFK;  3FV3 ABJ;  3GGX AEF;  3FV3 BDL;  3GGX CDE;  3FV3 EHP;  3FV3 EMN;  3GGX EGH;  3GGV BCD;  3GGV DEF;  3JVY AB;  3GGV ABG;  3GI6 AB;  3FV3 GHO;  3EC0 AB;  3FV3 ACK;  3FV3 FIN;  3EKP ACD;  3GGX CDH;  3GGV GHI;  3GGX ABF;  3GGX DGH;  3GGV EFG;  3GGA CDH;  3FV3 DFL;  3EL9 AB;  1AJV AB;  3FV3 BJ;  3EL4 AB;  3FV3 FGN;  3EM3 AB;  3FV3 BCJ;  3EKY AB;  1A8K ADE;  3DOX AP;  3FV3 EM;  3FV3 BHJ;  3GGX AGH;  3GGX ABE;  3GGX BGH;  3GGX GH;  1A8K AB;  3FV3 CDK;  3FV3 AGO;  3GGU AB;  3HBO AB;  3FV3 AI;  1A94 AB;  3GGA GH;  3GGV CEF;  3FV3 DEM;  3GGV CDG;  3EMY AB;  3FV3 BHP;  3FV3 AEI;  3H5B AB;  3GGV EF;  3JVW AB;  3EKV AB;  3GI4 AB;  3GGV EGH;  3FV3 GHP;  3FV3 BFJ;  3GGV CD;  3FV3 BJO;  3EKT BCD;  3FV3 CKN;  3GGA BGH;  3GGV AEF;  3FV3 ADI;  3GGV ABC;  3DK1 AB;  3EM4 ABU;  3FX5 AB;  3EKP ABC;  3FV3 CHP;  3EL0 AB;  3GGA ABG;  3FV3 AEM;  3EM4 ABV;  3EKW AB;  3FV3 AFI;  3GGA DGH;  3FV3 DHL;  3GGV ABI;  1A94 ADE;  3GGV ABF;  3FV3 CEK;  3GGV CDH;  3FV3 EGO;  3GGV CDI;  3EKP ABD;  3FV3 EF;  3GGA ABH;  1A30 AB;  1A8K ABE;  3FV3 DGO;  3EKT ABC;  3GGV ACD;  3FV3 AFN;  3FV3 FGO;  3FV3 HP;  3FV3 BCK;  3FV3 AHI;  3GGV CGH;  3FV3 ACI;  3FV3 CFN;  3FV3 CKP;  1AJX AB;  3EKP AB;  3GGX ABD;  1A30 ABC;  3GGV EFI;  1AAQ AB;  3EKT CD;  3FV3 BGO;  3FV3 DGL;  3FV3 DFN;  1A30 BC;  3FV3 ABI;  3FV3 AHP;  1A9M AB;  3FV3 CEM;  3GGV CDF;  3EM4 AUV;  3GGV BGH;  1A8K ABD;  3FV3 BDG;  3GGA ABC;  3FV3 EGM;  3FV3 EHM;  3GGV BEF;  1A8G AB;  3GGX ABC;  3EKT ACD;  3FV3 ABG;  3GGX EFG;  3GGX CD;  3EL5 AB;  1A94 ABE;  3FV3 EFM;  3FV3 FN; 
#chains in the LinkProt database with same CATH homology
 3HAU AB;  3EKX AB;  3GGV DGH;  1A8K BDE;  3FV3 EFN;  3GGA CD;  3EL1 AB;  3FV3 BDJ;  3GGX CDG;  1A94 BDE;  3GGX CGH;  3EM4 UV;  3FV3 AGI;  3FV3 CHK;  3EM4 AU;  3GGX AB;  3GGV ABH;  3GGX EF;  3DOX AQ;  3GGX ACD;  3FV3 DL;  3GGV ABE;  1A8K DE;  3GGX BCD;  3JW2 AB;  3ECG AB;  3FV3 BEM;  3EKP CD;  1A30 AC;  3GGV AB;  3EKT ABD;  3GGA CGH;  3GI0 AC;  3FV3 HNP;  3FV3 ADL;  3GI5 AB;  3GGA ABD;  3GGX FGH;  3IXO AB;  1AID AB;  3GGA BCD;  1A94 DE;  3EM4 AB;  3HAW AB;  3GGX ABG;  3EKQ AB;  3FV3 BGJ;  3GGV EFH;  3GGX ABH;  3GGV FGH;  3FV3 CIK;  3GGV CDE;  3HDK AB;  3FV3 DEF;  3GGX EFH;  3GGV GH;  3FV3 GO;  3GGX DEF;  3DOX APQ;  3GGX CEF;  3GGA CDG;  3FV3 CEF;  3GGA AGH;  3FV3 CK;  3FV3 DEL;  3FV3 EFH;  3GGX BEF;  3GGX CDF;  3GGV AGH;  3EM4 BUV;  3GGA AB;  3EKT AB;  1A94 ABD;  3FV3 CGO;  3FV3 BJL;  3FV3 EJM;  3EM6 AB;  3FV3 DLO;  3FV3 FHN;  3GGV ABD;  3GGA ACD;  3EKP BCD;  3FV3 CFK;  3FV3 ABJ;  3GGX AEF;  3FV3 BDL;  3GGX CDE;  3FV3 EHP;  3FV3 EMN;  3GGX EGH;  3GGV BCD;  3GGV DEF;  3JVY AB;  3GGV ABG;  3GI6 AB;  3FV3 GHO;  3EC0 AB;  3FV3 ACK;  3FV3 FIN;  3EKP ACD;  3GGX CDH;  3GGV GHI;  3GGX ABF;  3GGX DGH;  3GGV EFG;  3GGA CDH;  3FV3 DFL;  3EL9 AB;  1AJV AB;  3FV3 BJ;  3EL4 AB;  3FV3 FGN;  3EM3 AB;  3FV3 BCJ;  3EKY AB;  1A8K ADE;  3DOX AP;  3FV3 EM;  3FV3 BHJ;  3GGX AGH;  3GGX ABE;  3GGX BGH;  3GGX GH;  1A8K AB;  3FV3 CDK;  3FV3 AGO;  3GGU AB;  3HBO AB;  3FV3 AI;  1A94 AB;  3GGA GH;  3GGV CEF;  3FV3 DEM;  3GGV CDG;  3EMY AB;  3FV3 BHP;  3FV3 AEI;  3H5B AB;  3GGV EF;  3JVW AB;  3EKV AB;  3GI4 AB;  3GGV EGH;  3FV3 GHP;  3FV3 BFJ;  3GGV CD;  3FV3 BJO;  3EKT BCD;  3FV3 CKN;  3GGA BGH;  3GGV AEF;  3FV3 ADI;  3GGV ABC;  3DK1 AB;  3EM4 ABU;  3FX5 AB;  3EKP ABC;  3FV3 CHP;  3EL0 AB;  3GGA ABG;  3FV3 AEM;  3EM4 ABV;  3EKW AB;  3FV3 AFI;  3GGA DGH;  3FV3 DHL;  3GGV ABI;  1A94 ADE;  3GGV ABF;  3FV3 CEK;  3GGV CDH;  3FV3 EGO;  3GGV CDI;  3EKP ABD;  3FV3 EF;  3GGA ABH;  1A30 AB;  1A8K ABE;  3FV3 DGO;  3EKT ABC;  3GGV ACD;  3FV3 AFN;  3FV3 FGO;  3FV3 HP;  3FV3 BCK;  3FV3 AHI;  3GGV CGH;  3FV3 ACI;  3FV3 CFN;  3FV3 CKP;  1AJX AB;  3EKP AB;  3GGX ABD;  1A30 ABC;  3GGV EFI;  1AAQ AB;  3EKT CD;  3FV3 BGO;  3FV3 DGL;  3FV3 DFN;  1A30 BC;  3FV3 ABI;  3FV3 AHP;  1A9M AB;  3FV3 CEM;  3GGV CDF;  3EM4 AUV;  3GGV BGH;  1A8K ABD;  3FV3 BDG;  3GGA ABC;  3FV3 EGM;  3FV3 EHM;  3GGV BEF;  1A8G AB;  3GGX ABC;  3EKT ACD;  3FV3 ABG;  3GGX EFG;  3GGX CD;  3EL5 AB;  1A94 ABE;  3FV3 EFM;  3FV3 FN; 

5YOKA 5YOKB 2HS1A 2HS1B 3A2OA 3A2OB 3FX5A 3FX5B 2NMZA 2NMZB 6IXDA 6IXDB 3NU3A 3NU3B 3DJKA 3DJKB 1NH0A 1NH0B 3NDXA 3NDXB 2J9JA 2J9JB 2AVSA 2AVSB 2AVMA 2AVMB 3D20A 3D20B 3D1YA 3D1YB 2AVOA 2AVOB 3D1XA 3D1XB 3BVAA 3BVAB 4HE9A 4HE9B 2IDWA 2IDWB 2JE4A 2JE4B 3DK1A 3DK1B 2AOGA 2AOGB 2QD7A 2QD7B 4ZIPA 4ZIPB 1KZKA 1KZKB 2NMYA 2NMYB 6U7PA 6U7PB 4EJDA 4EJDB 3MWSA 3MWSB 6CDJA 6CDJB 3NDWA 3NDWB 6BRAA 6BRAB 3OXCA 3OXCB 3TOHA 3TOHB 3NU6A 3NU6B 3ECGA 3ECGB 6DV4A 6DV4B 5JG1A 5JG1B 3EBZA 3EBZB 2F8GA 2F8GB 1T3RA 1T3RB 3I6OA 3I6OB 2R8NA 3EC0A 3EC0B 4FL8A 4FL8B 2NNPA 2NNPB 5IVTA 5IVTB 6DV0A 6DV0B 3CYXA 3CYXB 2HS2A 2HS2B 6O54X 6DIFA 6DIFB 2QCIA 2QCIB 6PRFA 6PRFB 3NU4A 3NU4B 4DFGA 4DFGB 3NDUA 3NDUB 3NDUC 3NDUD 6E9AA 6E9AB 5DGUA 5DGUB 2F81A 2F81B 1SDUA 1SDUB 2AVQA 2AVQB 2NNKA 2NNKB 4HDPA 4HDPB 3VF5A 3VF5B 4MC9A 4MC9B 6CDLA 6CDLB 2AOCA 2AOCB 2J9KA 2J9KB 5UPZA 5UPZB 3OK9A 3OK9B 1K1TA 1K1TB 4KB9A 4KB9B 3S43A 3S43B 3H5BA 3H5BB 3SPKA 3SPKB 5AGZA 5AGZB 5WLOA 5WLOB 1TW7A 1TW7B 2AOFA 2AOFB 2QD6A 2QD6B 3NU5A 3NU5B 6DJ1A 6DJ1B 6E7JA 6E7JB 3D1ZA 3D1ZB 4FLGA 4FLGB 6B4NA 6B4NB 1SDTA 1SDTB 4U8WA 4U8WB 2A1EA 2A1EB 3VF7A 3VF7B 6U7OA 6U7OB 4HDFA 4HDFB 4YHQA 4YHQB 2QD8A 2QD8B 3BVBA 3BVBB 5BS4A 5BS4B 6DJ7A 6DJ7B 5UOVA 5UOVB 4J55A 4J55B 3NUOA 3NUOB 3TL9A 3TL9B 2HB3A 2HB3B 3IA9A 3IA9B 3HAUA 3HAUB 6DJ2A 6DJ2B 5AH8A 5AH8B 3KFRA 3KFRB 4MC6A 4MC6B 3HAWA 3HAWB 4YE3A 4YE3B 2G69A 5BRYA 5BRYB 1T7IA 1T7IB 2HC0A 2HC0B 3TKGA 3TKGB 3TKGC 3TKGD 3QN8A 3QN8B 2IENA 2IENB 3QIHA 3QIHB 3TH9A 3TH9B 4DQEA 4DQEB 3TOGA 3TOGB 3TOGC 3TOGD 3K4VA 3K4VB 3K4VC 3K4VD 2AODA 2AODB 3UCBA 3UCBB 2PC0A 2O4LA 2O4LB 2AOIA 2AOIB 1SDVA 1SDVB 3S54A 3S54B 4Z50A 4Z50B 4Z50C 4Z50D 3CYWA 3CYWB 3PWMA 3PWMB 3PWRA 3PWRB 4FM6A 4FM6B 3QAAA 3QAAB 2F80A 2F80B 4DJPA 4DJPB 3QP0A 3QP0B 4MC1A 4MC1B 4DJQA 4DJQB 3ST5A 3ST5B 6OTGA 6OTGB 3B7VA 3B7VB 2QNPA 2QNPB 5AHAA 5AHAB 3VFAA 3VFAB 2AVVA 2AVVB 2AVVD 2AVVE 5T2EA 4HEGA 4HEGB 2AOHA 2AOHB 5T2ZA 5T2ZB 3O9IA 3O9IB 2AOEA 2AOEB 3NUJA 3NUJB 3UFNA 3UFNB 4HDBA 4HDBB 4U7VA 4U7VB 3B80A 3B80B 3QBFA 3QBFB 3DCRA 3DCRB 6DILA 6DILB 2IEOA 2IEOB 2FNTA 2FNTB 2QNNA 2QNNB 4NPUA 4NPUB 2BB9A 2BB9B 3TOFA 3TOFB 6MCRA 3NYGA 3NYGB 6B3FA 6B3FB 3SA8A 3SA8B 5IVSA 5IVSB 5AH9A 5AH9B 3O9BA 3O9BB 3O9EA 3O9EB 2PWRA 2PWRB 6O48A 6O48B 4QJAA 4QJAB 4DQBA 4DQBB 5YOJA 5YOJB 2FGVA 2FGVB 4QJ6A 4QJ6B 4QJ6C 4QJ6D 6B38A 6B38B 4YOBA 3VFBA 3VFBB 3SACA 3SACB 1XL2A 1XL2B 4Q1YA 4Q1YB 2PK6A 2PK6B 2AOJA 2AOJB 2Z4OA 2Z4OB 2PQZA 2PQZB 6B3GA 6B3GB 3S45A 3S45B 5ULTA 5ULTB 3TKWA 3TKWB 3NWQA 3NWQB 4DJRA 4DJRB 5IVRA 5IVRB 3SABA 3SABB 5AHBA 5AHBB 3SA7A 3SA7B 4CPSA 4CPSB 5AH6A 5AH6B 2O4SA 2O4SB 3I2LA 3I2LB 3S53A 3S53B 2R43A 2R43B 2F3KA 2F3KB 1D4IA 1D4IB 5AHCA 5AHCB 3ZPSA 3ZPSB 5JFPA 5JFPB 4E43A 4E43B 4RVJA 4RVJB 4RVJC 4RVJD 1K1UA 1K1UB 3QPJA 3QPJB 6MCSA 3BXSA 3BXSB 2I4VA 2I4VB 1ZPKA 1ZPKB 2I4UA 2I4UB 3BXRA 3BXRB 6C8XA 6C8XB 4J54A 4J54B 4ZLSA 4ZLSB 5IVQA 5IVQB 6B3CA 6B3CB 3QROA 3QROB 3NDTA 3NDTB 3NDTC 3NDTD 4MC2A 4MC2B 3JVYB 6B3HA 6B3HB 2O4KA 2O4KB 4A6CA 4A6CB 3EKWA 3EKWB 5KR1A 5KR1B 3SA3A 3SA3B 1DAZC 1DAZD 3OXXA 3OXXB 3OXXC 3OXXD 3OUBA 3OUBB 3EL9A 3EL9B 5AH7A 5AH7B 6B36A 6B36B 5UFZA 5UFZB 3SA5A 3SA5B 3O9GA 3O9GB 3OU4A 3OU4B 5T84A 5T84B 3EL5A 3EL5B 4OBJA 4OBJB 2I4DA 2I4DB 3ZPTA 3ZPTB 4OBKA 4OBKB 3UF3A 3UF3B 5KQYA 5KQYB 6O5AA 6O5AB 2I4WA 2I4WB 3CKTA 3CKTB 6MK9A 6MK9B 3O9HA 3O9HB 6MKLA 6MKLB 3O9FA 3O9FB 4QJ7A 4QJ7B 4QJ7C 4QJ7D 4F75A 4F75B 4CPWA 4CPWB 5DGWA 5DGWB 2FDDA 2FDDB 3QRSA 3QRSB 4OBFA 4OBFB 4OBFC 4OBFD 4CPTA 4CPTB 3SA9A 3SA9B 4NPTA 6O5XA 6O5XB 6O5XC 6O5XD 3I8WA 3EL1A 3EL1B 3NLSA 3NLSB 3R0YA 3R0YB 3QRMA 3QRMB 5KQZA 5KQZB 2PSVA 2PSVB 2I4XA 2I4XB 3SA6A 3SA6B 3OXVA 3OXVB 3OXVC 3OXVD 6BZ2A 6BZ2B 4DJOA 4DJOB 3OUAA 3OUAB 2PWCA 2PWCB 4YOAA 3OTSA 3OTSB 2I0AA 2I0AB 3OU3A 3OU3B 1MTRA 1MTRB 1IDAA 1IDAB 1DIFA 1DIFB 2NPHA 2NPHB 2FXDA 2FXDB 4I8ZA 4I8ZB 3OQ7A 3KDBA 3KDBB 3R0WA 3R0WB 3OY4A 3OY4B 3OQDA 4QJ9A 4QJ9B 2P3AA 2P3AB 4DQHA 4DQHB 3HBOA 3HBOB 4Z4XA 4Z4XB 6O57A 6O57B 3GI5A 3GI5B 4GB2A 4GB2B 3OTYA 3OTYB 3IXOA 3IXOB 1IIQA 1IIQB 1D4LA 1D4LB 3EKVA 3EKVB 2QI4A 2QI4B 2ZGAA 5VCKA 5VCKB 4CPRA 4CPRB 4CP7A 4CP7B 2QHYA 2QHYB 1HVKA 1HVKB 3EKYA 3EKYB 3SA4A 3SA4B 1SP5A 1SP5B 3GI6A 3GI6B 2R3TA 2R3TB 1XL5A 1XL5B 3BHEA 3BHEB 4OBHA 4OBHB 4OBHC 4OBHD 1FFIC 1FFID 5KR0A 5KR0B 1HVIA 1HVIB 1K2BA 1K2BB 2QHZA 2QHZB 3I7EA 3I7EB 3ZPUA 3ZPUB 4F76A 4F76B 4NJSA 4NJSB 4NJSC 4NJSD 2BBBA 2BBBB 6DJ5A 6DJ5B 3BGCA 3BGCB 1PROA 1PROB 3LZUA 3LZUB 5KAOA 5KAOB 2R38A 2R38B 4NJUA 4NJUB 4NJUC 4NJUD 1HVLA 1HVLB 2UXZA 2UXZB 1B6LA 1B6LB 5KR2A 5KR2B 5KR2C 5KR2D 3GI4A 3GI4B 5E5KA 5E5KB 2QI6A 2QI6B 1EC0A 1EC0B 1HVHA 1HVHB 2CENA 2CENB 4NJVA 4NJVB 4NJVC 4NJVD 1W5VA 1W5VB 1W5WA 1W5WB 1QBSA 1QBSB 4Q1WA 4Q1WB 2QI5A 2QI5B 3M9FA 3M9FB 3HDKA 3HDKB 1HWRA 1HWRB 1QBRA 1QBRB 1QBUA 1QBUB 1B6JA 1B6JB 4J5JA 4J5JB 2QI7A 2QI7B 2Q54A 2Q54B 3O9DA 3O9DB 3O9CA 3O9CB 3OU1A 3OU1B 1HVRA 1HVRB 5TYRA 5TYRB 2PK5A 2PK5B 4EYRA 4EYRB 2RKFA 2RKFB 1Z1RA 1Z1RB 1EBWA 1EBWB 6OOSA 6OOSB 6OOSC 6OOSD 3BC4A 1G35A 1G35B 3OUDA 3OUDB 5B18A 5B18B 5B18C 5B18D 5JFUA 5JFUB 2RKGA 2RKGB 3DCKA 3DCKB 2WKZA 2WKZB 3JW2A 3JW2B 4OBGA 4OBGB 4OBGC 4OBGD 4K4RA 4K4RB 4K4QA 4K4QB 1Z1HA 1Z1HB 3MXEA 3MXEB 1D4HA 1D4HB 1BWBA 1BWBB 4F73A 4F73B 2PSUA 2PSUB 4A4QA 4A4QB 1HXWA 1HXWB 2FXEA 2FXEB 1D4JA 1D4JB 2O4PA 2O4PB 6OOTA 6OOTB 2UY0A 2UY0B 2PYNA 2PYNB 3KFSA 3KFSB 6OXUA 6OXUB 2HPEA 2HPEB 3KDDA 3KDDB 5T8HA 5T8HB 4NKKA 3GGUA 3GGUB 2Q55A 2Q55B 2QMPA 2QMPB 6DH3A 6DH3B 3KFNA 3KFNB 3KF0A 3KF0B 6D0DA 6D0DB 2AIDA 2AIDB 6DH8A 6DH8B 1FEJC 1FEJD 5E5JA 5E5JB 3MXDA 3MXDB 1B6MA 1B6MB 3O9AA 3O9AB 5YRSA 5YRSB 1IZHA 1IZHB 2I0DA 2I0DB 3R4BA 3R4BB 3S56A 3S56B 6OXYA 6OXYB 4Q1XA 4Q1XB 5COKA 5COKB 6DH0A 6DH0B 3BGBA 3BGBB 1HVJA 1HVJB 2QI1A 2QI1B 2FNSA 2FNSB 2R3WA 2R3WB 4DQFA 4DQFB 3NU9A 3NU9B 1FF0C 1FF0D 4EJKA 4EJKB 6C8YA 6C8YB 1MERA 1MERB 1AJXA 1AJXB 1W5YA 1W5YB 6OXTA 6OXTB 3OXWA 3OXWB 3OXWC 3OXWD 4QGIA 4QGIB 1MESA 1MESB 2QI3A 2QI3B 6OPVA 6OPVB 3SAAA 3SAAB 2NXLA 2NXLB 6OXZA 6OXZB 1FG6C 1FG6D 3KFPA 6OXPA 6OXPB 1HPVA 1HPVB 1ODXA 1ODXB 1HSGA 1HSGB 3O99A 3O99B 1D4YA 1D4YB 6OXQA 6OXQB 1MEUA 1MEUB 1ODYA 1ODYB 5CONA 5CONB 4A6BA 4A6BB 2XYFA 2XYFB 1HSHA 1HSHB 1HSHC 1HSHD 4DQCA 4DQCB 1B6KA 1B6KB 1META 1METB 2PYMA 2PYMB 1HIVA 1HIVB 6DH7A 6DH7B 6DH6A 6DH6B 1HPXA 1HPXB 3JVWA 3JVWB 2BPYA 2BPYB 1D4KA 1D4KB 4LL3A 4LL3B 6DH4A 6DH4B 1BWAA 1BWAB 4OBDA 4OBDB 4OBDC 4OBDD 1A8KA 1A8KB 1A8KD 1A8KE 4L1AA 4L1AB 6OPTA 6OPTB 1MT7A 1MT7B 1CPIA 1CPIB 4QJ8A 4QJ8B 4QJ8C 4QJ8D 5HVPA 5HVPB 5COOA 5COOB 6OXVA 6OXVB 1EC3A 1EC3B 1W5XA 1W5XB 1K6VA 1K6VB 3EKXA 3EKXB 1MT9A 1MT9B 2FGUA 2FGUB 3NWXA 3NWXB 1RPIA 1RPIB 2BPVA 2BPVB 4UPJA 4UPJB 4RVXA 4RVXB 4RVXC 4RVXD 6OY1A 6OY1B 2FLEA 2FLEB 4HLAA 4HLAB 6OY0A 6OY0B 2Q5KA 2Q5KB 1A94A 1A94B 1A94D 1A94E 1FG8C 1FG8D 1NPAA 1NPAB 6DGYA 6DGYB 1ZBGA 1ZBGB 4FE6A 1KJGA 1KJGB 5V4YA 6OXXA 6OXXB 4I8WA 4I8WB 1B6PA 1B6PB 1EBZA 1EBZB 1FGCC 1FGCD 1FFFC 1FFFD 6OXSA 6OXSB 1DW6C 1DW6D 6OXWA 6OXWB 6DH1A 6DH1B 6DGZA 6DGZB 1AJVA 1AJVB 6D0EA 6D0EB 1G2KA 1G2KB 6DH2A 6DH2B 6DH5A 6DH5B 1NPWA 1NPWB 1KJHA 1KJHB 3TLHA 2WL0A 2WL0B 2P3BA 2P3BB 1ODWA 1ODWB 4NJTA 4NJTB 4NJTC 4NJTD 2Q3KA 2Q3KB 2O4NA 2O4NB 1A30A 1A30B 4U7QA 4U7QB 1HIHA 1HIHB 3EL4A 3EL4B 1HTGA 1HTGB 3LZSA 3LZSB 6OY2A 6OY2B 1SGUA 1SGUB 1WBKA 1WBKB 6OPUA 6OPUB 6DGXA 6DGXB 1AXAA 1AXAB 1TSQA 1TSQB 1BV7A 1BV7B 4JECA 4JECB 2CEMA 2CEMB 2QI0A 2QI0B 1F7AA 1F7AB 2NXDA 2NXDB 1BV9A 1BV9B 5TYSA 5TYSB 3OUCA 3OUCB 6OXRA 6OXRB 3EL0A 3EL0B 4FAFA 4FAFB 1ZP8A 1ZPAA 1KJFA 1KJFB 1HIIA 1HIIB 3EKTA 3EKTB 3EKTC 3EKTD 4PHVA 4PHVB 6OXOA 6OXOB 1AZ5A 1HEFE 5COPA 5COPB 1HVSA 1HVSB 1KJ7A 1KJ7B 3PSUA 3U7SA 3U7SB 1EBKC 1EBKD 1EBKE 1EBKF 3EM4A 3EM4B 3EM4U 3EM4V 1MRXA 1MRXB 3T3CA 3T3CB 7UPJA 7UPJB 1ZSRA 1ZSRB 1MSMA 1MSMB 1EC2A 1EC2B 1NPVA 1NPVB 1DMPA 1DMPB 1ZJ7A 4GZFA 4GZFB 3EM6A 3EM6B 4F74A 4F74B 1ZTZA 1ZTZB 1QBTA 1QBTB 4M8XA 4M8XB 1ZSFA 1ZSFB 4QJ2A 4QJ2B 4QJ2C 4QJ2D 1WBMA 1WBMB 5VEAA 1MRWA 1MRWB 3LZVA 3LZVB 1AIDA 1AIDB 2XYEA 2XYEB 2MIPA 2MIPB 2MIPC 2MIPD 1MSNA 1MSNB 5VJ3A 1OHRA 1OHRB 2P3CA 2P3CB 3KDCA 3KDCB 1IDBA 1IDBB 1RL8A 1RL8B 2AZBA 1IZIA 1IZIB 2AQUA 2AQUB 1EC1A 1EC1B 1K6PA 1K6PB 2BQVA 2BQVB 7HVPA 7HVPB 2AZCA 2AZCB 1TSUA 1TSUB 4RVIA 4RVIB 4RVIC 4RVID 1HEGE 4TVHA 4TVHB 6OPYA 6OPYB 3EM3A 3EM3B 6UPJA 6UPJB 3EKPA 3EKPB 3EKPC 3EKPD 2AZ8A 1SIPA 1Z8CA 1Z8CB 3T11A 3T11B 2Q63A 2Q63B 6OOUA 6OOUB 8HVPA 8HVPB 1HTFA 1HTFB 1GNOA 1GNOB 1K6CA 1K6CB 1K6TA 1K6TB 1GNMA 1GNMB 4TVGA 4TVGB 4HVPA 4HVPB 1HBVA 1HBVB 3EKQA 3EKQB 1UPJA 1MT8A 1MT8B 1YTHA 1YTHB 1YTGA 1YTGB 6OPSA 6OPSB 1TCXA 1TCXB 2NXMA 2NXMB 1K2CA 1K2CB 5UPJA 5UPJB 1T7JA 1T7JB 1GNNA 1GNNB 1EBYA 1EBYB 1HXBA 1HXBB 1A8GA 1A8GB 1A9MA 1A9MB 2QAKA 2QAKB 4M8YA 4M8YB 1HOSA 1HOSB 3TTPA 3TTPB 4CPUA 4CPUB 1SBGA 1SBGB 1LZQA 1LZQB 2B7ZA 2B7ZB 4K4PA 4K4PB 6OPXA 6OPXB 4GYEA 4GYEB 1YTIA 1U8GA 1U8GB 1HPSA 1HPSB 3OQAA 1C70A 1C70B 5KQXA 5KQXB 1VIJA 1VIJB 1VIKA 1VIKB 2B60A 2B60B 1HSIA 1HSIB 4EJ8A 4EJ8B 1N49A 1N49B 1N49C 1N49D 4FAEA 4FAEB 4CPXA 4CPXB 2Z54A 2Z54B 2QNQA 2QNQB 4COEA 4COEB 2BPZA 2BPZB 2A4FA 2A4FB 3UPJA 3UPJB 1ZLFA 1ZLFB 1M0BA 1M0BB 2HB4A 2SAMA 1YTJA 3UHLA 3UHLB 3UHLC 3UHLD 2R5PA 2R5PB 2R5PC 2R5PD 1D4SA 1D4SB 1JLDA 1JLDB 1HPOA 1HPOB 1C6YA 1C6YB 1C6ZA 1C6ZB 3AIDA 3AIDB 1TCWA 1TCWB 2Q64A 2Q64B 6OPZA 6OPZB 4EJLA 4EJLB 6OPWA 6OPWB 1SIVA 1SIVB 1AAQA 1AAQB 1MTBA 1MTBB 1BDQA 1BDQB 1IVPA 1IVPB 1C6XA 1C6XB 3PJ6A 1IVQA 1IVQB 1FB7A 1HTEA 1HTEB 4CPQA 4CPQB 2BPWA 2BPWB 2UPJA 2UPJB 2HPFA 2HPFB 1SH9A 1SH9B 2BPXA 2BPXB 2R5QA 2R5QB 2R5QC 2R5QD 1HHPA 9HVPA 9HVPB 3PHVA 3HVPA 3GGAA 3GGAB 3GGAC 3GGAD 3GGAG 3GGAH 2P3DA 2P3DB 2FDEA 2FDEB 2CEJA 2CEJB 2QHCA 2QHCB 3GGXA 3GGXB 3GGXC 3GGXD 3GGXE 3GGXF 3GGXG 3GGXH 4DQGA 4DQGB 1BDLA 1BDLB 1BDRA 1BDRB 3D3TA 3D3TB 2AZ9A 3U71A 1KJ4A 1KJ4B 1KJ4C 1KJ4D 2HB2A 1FQXA 1FQXB 1RQ9A 1RQ9B 3SO9A 3SO9B 3S85A 3S85B 3S85C 3S85D 3S85E 3S85F 3S85G 3S85H 3S85I 3S85J 3S85K 3S85L 3GGVA 3GGVB 3GGVC 3GGVD 3GGVE 3GGVF 3GGVG 3GGVH 3GGVI 1RV7A 1RV7B 5W5WA 5W5WB 1YT9A 1YT9B 1T7KA 1T7KB 1MUIA 1MUIB 2ZYEA 2ZYEB 1Q9PA 1BVEA 1BVEB 1BVGA 1BVGB 2HVPA 5YOKA 5YOKB 2HS1A 2HS1B 3A2OA 3A2OB 3FX5A 3FX5B 2NMZA 2NMZB 6IXDA 6IXDB 3NU3A 3NU3B 3DJKA 3DJKB 1NH0A 1NH0B 3NDXA 3NDXB 2J9JA 2J9JB 2AVSA 2AVSB 2AVMA 2AVMB 3D20A 3D20B 3D1YA 3D1YB 2AVOA 2AVOB 3D1XA 3D1XB 3BVAA 3BVAB 4HE9A 4HE9B 2IDWA 2IDWB 2JE4A 2JE4B 3DK1A 3DK1B 2AOGA 2AOGB 2QD7A 2QD7B 4ZIPA 4ZIPB 1KZKA 1KZKB 2NMYA 2NMYB 6U7PA 6U7PB 4EJDA 4EJDB 3MWSA 3MWSB 6CDJA 6CDJB 3NDWA 3NDWB 6BRAA 6BRAB 3OXCA 3OXCB 3TOHA 3TOHB 3NU6A 3NU6B 3ECGA 3ECGB 6DV4A 6DV4B 5JG1A 5JG1B 3EBZA 3EBZB 2F8GA 2F8GB 1T3RA 1T3RB 3I6OA 3I6OB 2R8NA 3EC0A 3EC0B 4FL8A 4FL8B 2NNPA 2NNPB 5IVTA 5IVTB 6DV0A 6DV0B 3CYXA 3CYXB 2HS2A 2HS2B 6O54X 6DIFA 6DIFB 2QCIA 2QCIB 6PRFA 6PRFB 3NU4A 3NU4B 4DFGA 4DFGB 3NDUA 3NDUB 3NDUC 3NDUD 6E9AA 6E9AB 5DGUA 5DGUB 2F81A 2F81B 1SDUA 1SDUB 2AVQA 2AVQB 2NNKA 2NNKB 4HDPA 4HDPB 3VF5A 3VF5B 4MC9A 4MC9B 6CDLA 6CDLB 2AOCA 2AOCB 2J9KA 2J9KB 5UPZA 5UPZB 3OK9A 3OK9B 1K1TA 1K1TB 4KB9A 4KB9B 3S43A 3S43B 3H5BA 3H5BB 3SPKA 3SPKB 5AGZA 5AGZB 5WLOA 5WLOB 1TW7A 1TW7B 2AOFA 2AOFB 2QD6A 2QD6B 3NU5A 3NU5B 6DJ1A 6DJ1B 6E7JA 6E7JB 3D1ZA 3D1ZB 4FLGA 4FLGB 6B4NA 6B4NB 1SDTA 1SDTB 4U8WA 4U8WB 2A1EA 2A1EB 3VF7A 3VF7B 6U7OA 6U7OB 4HDFA 4HDFB 4YHQA 4YHQB 2QD8A 2QD8B 3BVBA 3BVBB 5BS4A 5BS4B 6DJ7A 6DJ7B 5UOVA 5UOVB 4J55A 4J55B 3NUOA 3NUOB 3TL9A 3TL9B 2HB3A 2HB3B 3IA9A 3IA9B 3HAUA 3HAUB 6DJ2A 6DJ2B 5AH8A 5AH8B 3KFRA 3KFRB 4MC6A 4MC6B 3HAWA 3HAWB 4YE3A 4YE3B 2G69A 5BRYA 5BRYB 1T7IA 1T7IB 2HC0A 2HC0B 3TKGA 3TKGB 3TKGC 3TKGD 3QN8A 3QN8B 2IENA 2IENB 3QIHA 3QIHB 3TH9A 3TH9B 4DQEA 4DQEB 3TOGA 3TOGB 3TOGC 3TOGD 3K4VA 3K4VB 3K4VC 3K4VD 2AODA 2AODB 3UCBA 3UCBB 2PC0A 2O4LA 2O4LB 2AOIA 2AOIB 1SDVA 1SDVB 3S54A 3S54B 4Z50A 4Z50B 4Z50C 4Z50D 3CYWA 3CYWB 3PWMA 3PWMB 3PWRA 3PWRB 4FM6A 4FM6B 3QAAA 3QAAB 2F80A 2F80B 4DJPA 4DJPB 3QP0A 3QP0B 4MC1A 4MC1B 4DJQA 4DJQB 3ST5A 3ST5B 6OTGA 6OTGB 3B7VA 3B7VB 2QNPA 2QNPB 5AHAA 5AHAB 3VFAA 3VFAB 2AVVA 2AVVB 2AVVD 2AVVE 5T2EA 4HEGA 4HEGB 2AOHA 2AOHB 5T2ZA 5T2ZB 3O9IA 3O9IB 2AOEA 2AOEB 3NUJA 3NUJB 3UFNA 3UFNB 4HDBA 4HDBB 4U7VA 4U7VB 3B80A 3B80B 3QBFA 3QBFB 3DCRA 3DCRB 6DILA 6DILB 2IEOA 2IEOB 2FNTA 2FNTB 2QNNA 2QNNB 4NPUA 4NPUB 2BB9A 2BB9B 3TOFA 3TOFB 6MCRA 3NYGA 3NYGB 6B3FA 6B3FB 3SA8A 3SA8B 5IVSA 5IVSB 5AH9A 5AH9B 3O9BA 3O9BB 3O9EA 3O9EB 2PWRA 2PWRB 6O48A 6O48B 4QJAA 4QJAB 4DQBA 4DQBB 5YOJA 5YOJB 2FGVA 2FGVB 4QJ6A 4QJ6B 4QJ6C 4QJ6D 6B38A 6B38B 4YOBA 3VFBA 3VFBB 3SACA 3SACB 1XL2A 1XL2B 4Q1YA 4Q1YB 2PK6A 2PK6B 2AOJA 2AOJB 2Z4OA 2Z4OB 2PQZA 2PQZB 6B3GA 6B3GB 3S45A 3S45B 5ULTA 5ULTB 3TKWA 3TKWB 3NWQA 3NWQB 4DJRA 4DJRB 5IVRA 5IVRB 3SABA 3SABB 5AHBA 5AHBB 3SA7A 3SA7B 4CPSA 4CPSB 5AH6A 5AH6B 2O4SA 2O4SB 3I2LA 3I2LB 3S53A 3S53B 2R43A 2R43B 2F3KA 2F3KB 1D4IA 1D4IB 5AHCA 5AHCB 3ZPSA 3ZPSB 5JFPA 5JFPB 4E43A 4E43B 4RVJA 4RVJB 4RVJC 4RVJD 1K1UA 1K1UB 3QPJA 3QPJB 6MCSA 3BXSA 3BXSB 2I4VA 2I4VB 1ZPKA 1ZPKB 2I4UA 2I4UB 3BXRA 3BXRB 6C8XA 6C8XB 4J54A 4J54B 4ZLSA 4ZLSB 5IVQA 5IVQB 6B3CA 6B3CB 3QROA 3QROB 3NDTA 3NDTB 3NDTC 3NDTD 4MC2A 4MC2B 3JVYA 6B3HA 6B3HB 2O4KA 2O4KB 4A6CA 4A6CB 3EKWA 3EKWB 5KR1A 5KR1B 3SA3A 3SA3B 1DAZC 1DAZD 3OXXA 3OXXB 3OXXC 3OXXD 3OUBA 3OUBB 3EL9A 3EL9B 5AH7A 5AH7B 6B36A 6B36B 5UFZA 5UFZB 3SA5A 3SA5B 3O9GA 3O9GB 3OU4A 3OU4B 5T84A 5T84B 3EL5A 3EL5B 4OBJA 4OBJB 2I4DA 2I4DB 3ZPTA 3ZPTB 4OBKA 4OBKB 3UF3A 3UF3B 5KQYA 5KQYB 6O5AA 6O5AB 2I4WA 2I4WB 3CKTA 3CKTB 6MK9A 6MK9B 3O9HA 3O9HB 6MKLA 6MKLB 3O9FA 3O9FB 4QJ7A 4QJ7B 4QJ7C 4QJ7D 4F75A 4F75B 4CPWA 4CPWB 5DGWA 5DGWB 2FDDA 2FDDB 3QRSA 3QRSB 4OBFA 4OBFB 4OBFC 4OBFD 4CPTA 4CPTB 3SA9A 3SA9B 4NPTA 6O5XA 6O5XB 6O5XC 6O5XD 3I8WA 3EL1A 3EL1B 3NLSA 3NLSB 3R0YA 3R0YB 3QRMA 3QRMB 5KQZA 5KQZB 2PSVA 2PSVB 2I4XA 2I4XB 3SA6A 3SA6B 3OXVA 3OXVB 3OXVC 3OXVD 6BZ2A 6BZ2B 4DJOA 4DJOB 3OUAA 3OUAB 2PWCA 2PWCB 4YOAA 3OTSA 3OTSB 2I0AA 2I0AB 3OU3A 3OU3B 1MTRA 1MTRB 1IDAA 1IDAB 1DIFA 1DIFB 2NPHA 2NPHB 2FXDA 2FXDB 4I8ZA 4I8ZB 3OQ7A 3KDBA 3KDBB 3R0WA 3R0WB 3OY4A 3OY4B 3OQDA 4QJ9A 4QJ9B 2P3AA 2P3AB 4DQHA 4DQHB 3HBOA 3HBOB 4Z4XA 4Z4XB 6O57A 6O57B 3GI5A 3GI5B 4GB2A 4GB2B 3OTYA 3OTYB 3IXOA 3IXOB 1IIQA 1IIQB 1D4LA 1D4LB 3EKVA 3EKVB 2QI4A 2QI4B 2ZGAA 5VCKA 5VCKB 4CPRA 4CPRB 4CP7A 4CP7B 2QHYA 2QHYB 1HVKA 1HVKB 3EKYA 3EKYB 3SA4A 3SA4B 1SP5A 1SP5B 3GI6A 3GI6B 2R3TA 2R3TB 1XL5A 1XL5B 3BHEA 3BHEB 4OBHA 4OBHB 4OBHC 4OBHD 1FFIC 1FFID 5KR0A 5KR0B 1HVIA 1HVIB 1K2BA 1K2BB 2QHZA 2QHZB 3I7EA 3I7EB 3ZPUA 3ZPUB 4F76A 4F76B 4NJSA 4NJSB 4NJSC 4NJSD 2BBBA 2BBBB 6DJ5A 6DJ5B 3BGCA 3BGCB 1PROA 1PROB 3LZUA 3LZUB 5KAOA 5KAOB 2R38A 2R38B 4NJUA 4NJUB 4NJUC 4NJUD 1HVLA 1HVLB 2UXZA 2UXZB 1B6LA 1B6LB 5KR2A 5KR2B 5KR2C 5KR2D 3GI4A 3GI4B 5E5KA 5E5KB 2QI6A 2QI6B 1EC0A 1EC0B 1HVHA 1HVHB 2CENA 2CENB 4NJVA 4NJVB 4NJVC 4NJVD 1W5VA 1W5VB 1W5WA 1W5WB 1QBSA 1QBSB 4Q1WA 4Q1WB 2QI5A 2QI5B 3M9FA 3M9FB 3HDKA 3HDKB 1HWRA 1HWRB 1QBRA 1QBRB 1QBUA 1QBUB 1B6JA 1B6JB 4J5JA 4J5JB 2QI7A 2QI7B 2Q54A 2Q54B 3O9DA 3O9DB 3O9CA 3O9CB 3OU1A 3OU1B 1HVRA 1HVRB 5TYRA 5TYRB 2PK5A 2PK5B 4EYRA 4EYRB 2RKFA 2RKFB 1Z1RA 1Z1RB 1EBWA 1EBWB 6OOSA 6OOSB 6OOSC 6OOSD 3BC4A 1G35A 1G35B 3OUDA 3OUDB 5B18A 5B18B 5B18C 5B18D 5JFUA 5JFUB 2RKGA 2RKGB 3DCKA 3DCKB 2WKZA 2WKZB 3JW2A 3JW2B 4OBGA 4OBGB 4OBGC 4OBGD 4K4RA 4K4RB 4K4QA 4K4QB 1Z1HA 1Z1HB 3MXEA 3MXEB 1D4HA 1D4HB 1BWBA 1BWBB 4F73A 4F73B 2PSUA 2PSUB 4A4QA 4A4QB 1HXWA 1HXWB 2FXEA 2FXEB 1D4JA 1D4JB 2O4PA 2O4PB 6OOTA 6OOTB 2UY0A 2UY0B 2PYNA 2PYNB 3KFSA 3KFSB 6OXUA 6OXUB 2HPEA 2HPEB 3KDDA 3KDDB 5T8HA 5T8HB 4NKKA 3GGUA 3GGUB 2Q55A 2Q55B 2QMPA 2QMPB 6DH3A 6DH3B 3KFNA 3KFNB 3KF0A 3KF0B 6D0DA 6D0DB 2AIDA 2AIDB 6DH8A 6DH8B 1FEJC 1FEJD 5E5JA 5E5JB 3MXDA 3MXDB 1B6MA 1B6MB 3O9AA 3O9AB 5YRSA 5YRSB 1IZHA 1IZHB 2I0DA 2I0DB 3R4BA 3R4BB 3S56A 3S56B 6OXYA 6OXYB 4Q1XA 4Q1XB 5COKA 5COKB 6DH0A 6DH0B 3BGBA 3BGBB 1HVJA 1HVJB 2QI1A 2QI1B 2FNSA 2FNSB 2R3WA 2R3WB 4DQFA 4DQFB 3NU9A 3NU9B 1FF0C 1FF0D 4EJKA 4EJKB 6C8YA 6C8YB 1MERA 1MERB 1AJXA 1AJXB 1W5YA 1W5YB 6OXTA 6OXTB 3OXWA 3OXWB 3OXWC 3OXWD 4QGIA 4QGIB 1MESA 1MESB 2QI3A 2QI3B 6OPVA 6OPVB 3SAAA 3SAAB 2NXLA 2NXLB 6OXZA 6OXZB 1FG6C 1FG6D 3KFPA 6OXPA 6OXPB 1HPVA 1HPVB 1ODXA 1ODXB 1HSGA 1HSGB 3O99A 3O99B 1D4YA 1D4YB 6OXQA 6OXQB 1MEUA 1MEUB 1ODYA 1ODYB 5CONA 5CONB 4A6BA 4A6BB 2XYFA 2XYFB 1HSHA 1HSHB 1HSHC 1HSHD 4DQCA 4DQCB 1B6KA 1B6KB 1META 1METB 2PYMA 2PYMB 1HIVA 1HIVB 6DH7A 6DH7B 6DH6A 6DH6B 1HPXA 1HPXB 3JVWA 3JVWB 2BPYA 2BPYB 1D4KA 1D4KB 4LL3A 4LL3B 6DH4A 6DH4B 1BWAA 1BWAB 4OBDA 4OBDB 4OBDC 4OBDD 1A8KA 1A8KB 1A8KD 1A8KE 4L1AA 4L1AB 6OPTA 6OPTB 1MT7A 1MT7B 1CPIA 1CPIB 4QJ8A 4QJ8B 4QJ8C 4QJ8D 5HVPA 5HVPB 5COOA 5COOB 6OXVA 6OXVB 1EC3A 1EC3B 1W5XA 1W5XB 1K6VA 1K6VB 3EKXA 3EKXB 1MT9A 1MT9B 2FGUA 2FGUB 3NWXA 3NWXB 1RPIA 1RPIB 2BPVA 2BPVB 4UPJA 4UPJB 4RVXA 4RVXB 4RVXC 4RVXD 6OY1A 6OY1B 2FLEA 2FLEB 4HLAA 4HLAB 6OY0A 6OY0B 2Q5KA 2Q5KB 1A94A 1A94B 1A94D 1A94E 1FG8C 1FG8D 1NPAA 1NPAB 6DGYA 6DGYB 1ZBGA 1ZBGB 4FE6A 1KJGA 1KJGB 5V4YA 6OXXA 6OXXB 4I8WA 4I8WB 1B6PA 1B6PB 1EBZA 1EBZB 1FGCC 1FGCD 1FFFC 1FFFD 6OXSA 6OXSB 1DW6C 1DW6D 6OXWA 6OXWB 6DH1A 6DH1B 6DGZA 6DGZB 1AJVA 1AJVB 6D0EA 6D0EB 1G2KA 1G2KB 6DH2A 6DH2B 6DH5A 6DH5B 1NPWA 1NPWB 1KJHA 1KJHB 3TLHA 2WL0A 2WL0B 2P3BA 2P3BB 1ODWA 1ODWB 4NJTA 4NJTB 4NJTC 4NJTD 2Q3KA 2Q3KB 2O4NA 2O4NB 1A30A 1A30B 4U7QA 4U7QB 1HIHA 1HIHB 3EL4A 3EL4B 1HTGA 1HTGB 3LZSA 3LZSB 6OY2A 6OY2B 1SGUA 1SGUB 1WBKA 1WBKB 6OPUA 6OPUB 6DGXA 6DGXB 1AXAA 1AXAB 1TSQA 1TSQB 1BV7A 1BV7B 4JECA 4JECB 2CEMA 2CEMB 2QI0A 2QI0B 1F7AA 1F7AB 2NXDA 2NXDB 1BV9A 1BV9B 5TYSA 5TYSB 3OUCA 3OUCB 6OXRA 6OXRB 3EL0A 3EL0B 4FAFA 4FAFB 1ZP8A 1ZPAA 1KJFA 1KJFB 1HIIA 1HIIB 3EKTA 3EKTB 3EKTC 3EKTD 4PHVA 4PHVB 6OXOA 6OXOB 1AZ5A 1HEFE 5COPA 5COPB 1HVSA 1HVSB 1KJ7A 1KJ7B 3PSUA 3U7SA 3U7SB 1EBKC 1EBKD 1EBKE 1EBKF 3EM4A 3EM4B 3EM4U 3EM4V 1MRXA 1MRXB 3T3CA 3T3CB 7UPJA 7UPJB 1ZSRA 1ZSRB 1MSMA 1MSMB 1EC2A 1EC2B 1NPVA 1NPVB 1DMPA 1DMPB 1ZJ7A 4GZFA 4GZFB 3EM6A 3EM6B 4F74A 4F74B 1ZTZA 1ZTZB 1QBTA 1QBTB 4M8XA 4M8XB 1ZSFA 1ZSFB 4QJ2A 4QJ2B 4QJ2C 4QJ2D 1WBMA 1WBMB 5VEAA 1MRWA 1MRWB 3LZVA 3LZVB 1AIDA 1AIDB 2XYEA 2XYEB 2MIPA 2MIPB 2MIPC 2MIPD 1MSNA 1MSNB 5VJ3A 1OHRA 1OHRB 2P3CA 2P3CB 3KDCA 3KDCB 1IDBA 1IDBB 1RL8A 1RL8B 2AZBA 1IZIA 1IZIB 2AQUA 2AQUB 1EC1A 1EC1B 1K6PA 1K6PB 2BQVA 2BQVB 7HVPA 7HVPB 2AZCA 2AZCB 1TSUA 1TSUB 4RVIA 4RVIB 4RVIC 4RVID 1HEGE 4TVHA 4TVHB 6OPYA 6OPYB 3EM3A 3EM3B 6UPJA 6UPJB 3EKPA 3EKPB 3EKPC 3EKPD 2AZ8A 1SIPA 1Z8CA 1Z8CB 3T11A 3T11B 2Q63A 2Q63B 6OOUA 6OOUB 8HVPA 8HVPB 1HTFA 1HTFB 1GNOA 1GNOB 1K6CA 1K6CB 1K6TA 1K6TB 1GNMA 1GNMB 4TVGA 4TVGB 4HVPA 4HVPB 1HBVA 1HBVB 3EKQA 3EKQB 1UPJA 1MT8A 1MT8B 1YTHA 1YTHB 1YTGA 1YTGB 6OPSA 6OPSB 1TCXA 1TCXB 2NXMA 2NXMB 1K2CA 1K2CB 5UPJA 5UPJB 1T7JA 1T7JB 1GNNA 1GNNB 1EBYA 1EBYB 1HXBA 1HXBB 1A8GA 1A8GB 1A9MA 1A9MB 2QAKA 2QAKB 4M8YA 4M8YB 1HOSA 1HOSB 3TTPA 3TTPB 4CPUA 4CPUB 1SBGA 1SBGB 1LZQA 1LZQB 2B7ZA 2B7ZB 4K4PA 4K4PB 6OPXA 6OPXB 4GYEA 4GYEB 1YTIA 1U8GA 1U8GB 1HPSA 1HPSB 3OQAA 1C70A 1C70B 5KQXA 5KQXB 1VIJA 1VIJB 1VIKA 1VIKB 2B60A 2B60B 1HSIA 1HSIB 4EJ8A 4EJ8B 1N49A 1N49B 1N49C 1N49D 4FAEA 4FAEB 4CPXA 4CPXB 2Z54A 2Z54B 2QNQA 2QNQB 4COEA 4COEB 2BPZA 2BPZB 2A4FA 2A4FB 3UPJA 3UPJB 1ZLFA 1ZLFB 1M0BA 1M0BB 2HB4A 2SAMA 1YTJA 3UHLA 3UHLB 3UHLC 3UHLD 2R5PA 2R5PB 2R5PC 2R5PD 1D4SA 1D4SB 1JLDA 1JLDB 1HPOA 1HPOB 1C6YA 1C6YB 1C6ZA 1C6ZB 3AIDA 3AIDB 1TCWA 1TCWB 2Q64A 2Q64B 6OPZA 6OPZB 4EJLA 4EJLB 6OPWA 6OPWB 1SIVA 1SIVB 1AAQA 1AAQB 1MTBA 1MTBB 1BDQA 1BDQB 1IVPA 1IVPB 1C6XA 1C6XB 3PJ6A 1IVQA 1IVQB 1FB7A 1HTEA 1HTEB 4CPQA 4CPQB 2BPWA 2BPWB 2UPJA 2UPJB 2HPFA 2HPFB 1SH9A 1SH9B 2BPXA 2BPXB 2R5QA 2R5QB 2R5QC 2R5QD 1HHPA 9HVPA 9HVPB 3PHVA 3HVPA 3GGAA 3GGAB 3GGAC 3GGAD 3GGAG 3GGAH 2P3DA 2P3DB 2FDEA 2FDEB 2CEJA 2CEJB 2QHCA 2QHCB 3GGXA 3GGXB 3GGXC 3GGXD 3GGXE 3GGXF 3GGXG 3GGXH 4DQGA 4DQGB 1BDLA 1BDLB 1BDRA 1BDRB 3D3TA 3D3TB 2AZ9A 3U71A 1KJ4A 1KJ4B 1KJ4C 1KJ4D 2HB2A 1FQXA 1FQXB 1RQ9A 1RQ9B 3SO9A 3SO9B 3S85A 3S85B 3S85C 3S85D 3S85E 3S85F 3S85G 3S85H 3S85I 3S85J 3S85K 3S85L 3GGVA 3GGVB 3GGVC 3GGVD 3GGVE 3GGVF 3GGVG 3GGVH 3GGVI 1RV7A 1RV7B 5W5WA 5W5WB 1YT9A 1YT9B 1T7KA 1T7KB 1MUIA 1MUIB 2ZYEA 2ZYEB 1Q9PA 1BVEA 1BVEB 1BVGA 1BVGB 2HVPA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5YOK_A;  5YOK_B;  2HS1_A;  2HS1_B;  3A2O_A;  3A2O_B;  3FX5_A;  3FX5_B;  2NMZ_A;  2NMZ_B;  6IXD_A;  6IXD_B;  3NU3_A;  3NU3_B;  3DJK_A;  3DJK_B;  1NH0_A;  1NH0_B;  3NDX_A;  3NDX_B;  2J9J_A;  2J9J_B;  2AVS_A;  2AVS_B;  2AVM_A;  2AVM_B;  3D20_A;  3D20_B;  3D1Y_A;  3D1Y_B;  2AVO_A;  2AVO_B;  3D1X_A;  3D1X_B;  3BVA_A;  3BVA_B;  4HE9_A;  4HE9_B;  2IDW_A;  2IDW_B;  2JE4_A;  2JE4_B;  3DK1_A;  3DK1_B;  2AOG_A;  2AOG_B;  2QD7_A;  2QD7_B;  4ZIP_A;  4ZIP_B;  1KZK_A;  1KZK_B;  2NMY_A;  2NMY_B;  6U7P_A;  6U7P_B;  4EJD_A;  4EJD_B;  3MWS_A;  3MWS_B;  6CDJ_A;  6CDJ_B;  3NDW_A;  3NDW_B;  6BRA_A;  6BRA_B;  3OXC_A;  3OXC_B;  3TOH_A;  3TOH_B;  3NU6_A;  3NU6_B;  3ECG_A;  3ECG_B;  6DV4_A;  6DV4_B;  5JG1_A;  5JG1_B;  3EBZ_A;  3EBZ_B;  2F8G_A;  2F8G_B;  1T3R_A;  1T3R_B;  3I6O_A;  3I6O_B;  2R8N_A;  3EC0_A;  3EC0_B;  4FL8_A;  4FL8_B;  2NNP_A;  2NNP_B;  5IVT_A;  5IVT_B;  6DV0_A;  6DV0_B;  3CYX_A;  3CYX_B;  2HS2_A;  2HS2_B;  6O54_X;  6DIF_A;  6DIF_B;  2QCI_A;  2QCI_B;  6PRF_A;  6PRF_B;  3NU4_A;  3NU4_B;  4DFG_A;  4DFG_B;  3NDU_A;  3NDU_B;  3NDU_C;  3NDU_D;  6E9A_A;  6E9A_B;  5DGU_A;  5DGU_B;  2F81_A;  2F81_B;  1SDU_A;  1SDU_B;  2AVQ_A;  2AVQ_B;  2NNK_A;  2NNK_B;  4HDP_A;  4HDP_B;  3VF5_A;  3VF5_B;  4MC9_A;  4MC9_B;  6CDL_A;  6CDL_B;  2AOC_A;  2AOC_B;  2J9K_A;  2J9K_B;  5UPZ_A;  5UPZ_B;  3OK9_A;  3OK9_B;  1K1T_A;  1K1T_B;  4KB9_A;  4KB9_B;  3S43_A;  3S43_B;  3H5B_A;  3H5B_B;  3SPK_A;  3SPK_B;  5AGZ_A;  5AGZ_B;  5WLO_A;  5WLO_B;  1TW7_A;  1TW7_B;  2AOF_A;  2AOF_B;  2QD6_A;  2QD6_B;  3NU5_A;  3NU5_B;  6DJ1_A;  6DJ1_B;  6E7J_A;  6E7J_B;  3D1Z_A;  3D1Z_B;  4FLG_A;  4FLG_B;  6B4N_A;  6B4N_B;  1SDT_A;  1SDT_B;  4U8W_A;  4U8W_B;  2A1E_A;  2A1E_B;  3VF7_A;  3VF7_B;  6U7O_A;  6U7O_B;  4HDF_A;  4HDF_B;  4YHQ_A;  4YHQ_B;  2QD8_A;  2QD8_B;  3BVB_A;  3BVB_B;  5BS4_A;  5BS4_B;  6DJ7_A;  6DJ7_B;  5UOV_A;  5UOV_B;  4J55_A;  4J55_B;  3NUO_A;  3NUO_B;  3TL9_A;  3TL9_B;  2HB3_A;  2HB3_B;  3IA9_A;  3IA9_B;  3HAU_A;  3HAU_B;  6DJ2_A;  6DJ2_B;  5AH8_A;  5AH8_B;  3KFR_A;  3KFR_B;  4MC6_A;  4MC6_B;  3HAW_A;  3HAW_B;  4YE3_A;  4YE3_B;  2G69_A;  5BRY_A;  5BRY_B;  1T7I_A;  1T7I_B;  2HC0_A;  2HC0_B;  3TKG_A;  3TKG_B;  3TKG_C;  3TKG_D;  3QN8_A;  3QN8_B;  2IEN_A;  2IEN_B;  3QIH_A;  3QIH_B;  3TH9_A;  3TH9_B;  4DQE_A;  4DQE_B;  3TOG_A;  3TOG_B;  3TOG_C;  3TOG_D;  3K4V_A;  3K4V_B;  3K4V_C;  3K4V_D;  2AOD_A;  2AOD_B;  3UCB_A;  3UCB_B;  2PC0_A;  2O4L_A;  2O4L_B;  2AOI_A;  2AOI_B;  1SDV_A;  1SDV_B;  3S54_A;  3S54_B;  4Z50_A;  4Z50_B;  4Z50_C;  4Z50_D;  3CYW_A;  3CYW_B;  3PWM_A;  3PWM_B;  3PWR_A;  3PWR_B;  4FM6_A;  4FM6_B;  3QAA_A;  3QAA_B;  2F80_A;  2F80_B;  4DJP_A;  4DJP_B;  3QP0_A;  3QP0_B;  4MC1_A;  4MC1_B;  4DJQ_A;  4DJQ_B;  3ST5_A;  3ST5_B;  6OTG_A;  6OTG_B;  3B7V_A;  3B7V_B;  2QNP_A;  2QNP_B;  5AHA_A;  5AHA_B;  3VFA_A;  3VFA_B;  2AVV_A;  2AVV_B;  2AVV_D;  2AVV_E;  5T2E_A;  4HEG_A;  4HEG_B;  2AOH_A;  2AOH_B;  5T2Z_A;  5T2Z_B;  3O9I_A;  3O9I_B;  2AOE_A;  2AOE_B;  3NUJ_A;  3NUJ_B;  3UFN_A;  3UFN_B;  4HDB_A;  4HDB_B;  4U7V_A;  4U7V_B;  3B80_A;  3B80_B;  3QBF_A;  3QBF_B;  3DCR_A;  3DCR_B;  6DIL_A;  6DIL_B;  2IEO_A;  2IEO_B;  2FNT_A;  2FNT_B;  2QNN_A;  2QNN_B;  4NPU_A;  4NPU_B;  2BB9_A;  2BB9_B;  3TOF_A;  3TOF_B;  6MCR_A;  3NYG_A;  3NYG_B;  6B3F_A;  6B3F_B;  3SA8_A;  3SA8_B;  5IVS_A;  5IVS_B;  5AH9_A;  5AH9_B;  3O9B_A;  3O9B_B;  3O9E_A;  3O9E_B;  2PWR_A;  2PWR_B;  6O48_A;  6O48_B;  4QJA_A;  4QJA_B;  4DQB_A;  4DQB_B;  5YOJ_A;  5YOJ_B;  2FGV_A;  2FGV_B;  4QJ6_A;  4QJ6_B;  4QJ6_C;  4QJ6_D;  6B38_A;  6B38_B;  4YOB_A;  3VFB_A;  3VFB_B;  3SAC_A;  3SAC_B;  1XL2_A;  1XL2_B;  4Q1Y_A;  4Q1Y_B;  2PK6_A;  2PK6_B;  2AOJ_A;  2AOJ_B;  2Z4O_A;  2Z4O_B;  2PQZ_A;  2PQZ_B;  6B3G_A;  6B3G_B;  3S45_A;  3S45_B;  5ULT_A;  5ULT_B;  3TKW_A;  3TKW_B;  3NWQ_A;  3NWQ_B;  4DJR_A;  4DJR_B;  5IVR_A;  5IVR_B;  3SAB_A;  3SAB_B;  5AHB_A;  5AHB_B;  3SA7_A;  3SA7_B;  4CPS_A;  4CPS_B;  5AH6_A;  5AH6_B;  2O4S_A;  2O4S_B;  3I2L_A;  3I2L_B;  3S53_A;  3S53_B;  2R43_A;  2R43_B;  2F3K_A;  2F3K_B;  1D4I_A;  1D4I_B;  5AHC_A;  5AHC_B;  3ZPS_A;  3ZPS_B;  5JFP_A;  5JFP_B;  4E43_A;  4E43_B;  4RVJ_A;  4RVJ_B;  4RVJ_C;  4RVJ_D;  1K1U_A;  1K1U_B;  3QPJ_A;  3QPJ_B;  6MCS_A;  3BXS_A;  3BXS_B;  2I4V_A;  2I4V_B;  1ZPK_A;  1ZPK_B;  2I4U_A;  2I4U_B;  3BXR_A;  3BXR_B;  6C8X_A;  6C8X_B;  4J54_A;  4J54_B;  4ZLS_A;  4ZLS_B;  5IVQ_A;  5IVQ_B;  6B3C_A;  6B3C_B;  3QRO_A;  3QRO_B;  3NDT_A;  3NDT_B;  3NDT_C;  3NDT_D;  4MC2_A;  4MC2_B;  3JVY_B;  6B3H_A;  6B3H_B;  2O4K_A;  2O4K_B;  4A6C_A;  4A6C_B;  3EKW_A;  3EKW_B;  5KR1_A;  5KR1_B;  3SA3_A;  3SA3_B;  1DAZ_C;  1DAZ_D;  3OXX_A;  3OXX_B;  3OXX_C;  3OXX_D;  3OUB_A;  3OUB_B;  3EL9_A;  3EL9_B;  5AH7_A;  5AH7_B;  6B36_A;  6B36_B;  5UFZ_A;  5UFZ_B;  3SA5_A;  3SA5_B;  3O9G_A;  3O9G_B;  3OU4_A;  3OU4_B;  5T84_A;  5T84_B;  3EL5_A;  3EL5_B;  4OBJ_A;  4OBJ_B;  2I4D_A;  2I4D_B;  3ZPT_A;  3ZPT_B;  4OBK_A;  4OBK_B;  3UF3_A;  3UF3_B;  5KQY_A;  5KQY_B;  6O5A_A;  6O5A_B;  2I4W_A;  2I4W_B;  3CKT_A;  3CKT_B;  6MK9_A;  6MK9_B;  3O9H_A;  3O9H_B;  6MKL_A;  6MKL_B;  3O9F_A;  3O9F_B;  4QJ7_A;  4QJ7_B;  4QJ7_C;  4QJ7_D;  4F75_A;  4F75_B;  4CPW_A;  4CPW_B;  5DGW_A;  5DGW_B;  2FDD_A;  2FDD_B;  3QRS_A;  3QRS_B;  4OBF_A;  4OBF_B;  4OBF_C;  4OBF_D;  4CPT_A;  4CPT_B;  3SA9_A;  3SA9_B;  4NPT_A;  6O5X_A;  6O5X_B;  6O5X_C;  6O5X_D;  3I8W_A;  3EL1_A;  3EL1_B;  3NLS_A;  3NLS_B;  3R0Y_A;  3R0Y_B;  3QRM_A;  3QRM_B;  5KQZ_A;  5KQZ_B;  2PSV_A;  2PSV_B;  2I4X_A;  2I4X_B;  3SA6_A;  3SA6_B;  3OXV_A;  3OXV_B;  3OXV_C;  3OXV_D;  6BZ2_A;  6BZ2_B;  4DJO_A;  4DJO_B;  3OUA_A;  3OUA_B;  2PWC_A;  2PWC_B;  4YOA_A;  3OTS_A;  3OTS_B;  2I0A_A;  2I0A_B;  3OU3_A;  3OU3_B;  1MTR_A;  1MTR_B;  1IDA_A;  1IDA_B;  1DIF_A;  1DIF_B;  2NPH_A;  2NPH_B;  2FXD_A;  2FXD_B;  4I8Z_A;  4I8Z_B;  3OQ7_A;  3KDB_A;  3KDB_B;  3R0W_A;  3R0W_B;  3OY4_A;  3OY4_B;  3OQD_A;  4QJ9_A;  4QJ9_B;  2P3A_A;  2P3A_B;  4DQH_A;  4DQH_B;  3HBO_A;  3HBO_B;  4Z4X_A;  4Z4X_B;  6O57_A;  6O57_B;  3GI5_A;  3GI5_B;  4GB2_A;  4GB2_B;  3OTY_A;  3OTY_B;  3IXO_A;  3IXO_B;  1IIQ_A;  1IIQ_B;  1D4L_A;  1D4L_B;  3EKV_A;  3EKV_B;  2QI4_A;  2QI4_B;  2ZGA_A;  5VCK_A;  5VCK_B;  4CPR_A;  4CPR_B;  4CP7_A;  4CP7_B;  2QHY_A;  2QHY_B;  1HVK_A;  1HVK_B;  3EKY_A;  3EKY_B;  3SA4_A;  3SA4_B;  1SP5_A;  1SP5_B;  3GI6_A;  3GI6_B;  2R3T_A;  2R3T_B;  1XL5_A;  1XL5_B;  3BHE_A;  3BHE_B;  4OBH_A;  4OBH_B;  4OBH_C;  4OBH_D;  1FFI_C;  1FFI_D;  5KR0_A;  5KR0_B;  1HVI_A;  1HVI_B;  1K2B_A;  1K2B_B;  2QHZ_A;  2QHZ_B;  3I7E_A;  3I7E_B;  3ZPU_A;  3ZPU_B;  4F76_A;  4F76_B;  4NJS_A;  4NJS_B;  4NJS_C;  4NJS_D;  2BBB_A;  2BBB_B;  6DJ5_A;  6DJ5_B;  3BGC_A;  3BGC_B;  1PRO_A;  1PRO_B;  3LZU_A;  3LZU_B;  5KAO_A;  5KAO_B;  2R38_A;  2R38_B;  4NJU_A;  4NJU_B;  4NJU_C;  4NJU_D;  1HVL_A;  1HVL_B;  2UXZ_A;  2UXZ_B;  1B6L_A;  1B6L_B;  5KR2_A;  5KR2_B;  5KR2_C;  5KR2_D;  3GI4_A;  3GI4_B;  5E5K_A;  5E5K_B;  2QI6_A;  2QI6_B;  1EC0_A;  1EC0_B;  1HVH_A;  1HVH_B;  2CEN_A;  2CEN_B;  4NJV_A;  4NJV_B;  4NJV_C;  4NJV_D;  1W5V_A;  1W5V_B;  1W5W_A;  1W5W_B;  1QBS_A;  1QBS_B;  4Q1W_A;  4Q1W_B;  2QI5_A;  2QI5_B;  3M9F_A;  3M9F_B;  3HDK_A;  3HDK_B;  1HWR_A;  1HWR_B;  1QBR_A;  1QBR_B;  1QBU_A;  1QBU_B;  1B6J_A;  1B6J_B;  4J5J_A;  4J5J_B;  2QI7_A;  2QI7_B;  2Q54_A;  2Q54_B;  3O9D_A;  3O9D_B;  3O9C_A;  3O9C_B;  3OU1_A;  3OU1_B;  1HVR_A;  1HVR_B;  5TYR_A;  5TYR_B;  2PK5_A;  2PK5_B;  4EYR_A;  4EYR_B;  2RKF_A;  2RKF_B;  1Z1R_A;  1Z1R_B;  1EBW_A;  1EBW_B;  6OOS_A;  6OOS_B;  6OOS_C;  6OOS_D;  3BC4_A;  1G35_A;  1G35_B;  3OUD_A;  3OUD_B;  5B18_A;  5B18_B;  5B18_C;  5B18_D;  5JFU_A;  5JFU_B;  2RKG_A;  2RKG_B;  3DCK_A;  3DCK_B;  2WKZ_A;  2WKZ_B;  3JW2_A;  3JW2_B;  4OBG_A;  4OBG_B;  4OBG_C;  4OBG_D;  4K4R_A;  4K4R_B;  4K4Q_A;  4K4Q_B;  1Z1H_A;  1Z1H_B;  3MXE_A;  3MXE_B;  1D4H_A;  1D4H_B;  1BWB_A;  1BWB_B;  4F73_A;  4F73_B;  2PSU_A;  2PSU_B;  4A4Q_A;  4A4Q_B;  1HXW_A;  1HXW_B;  2FXE_A;  2FXE_B;  1D4J_A;  1D4J_B;  2O4P_A;  2O4P_B;  6OOT_A;  6OOT_B;  2UY0_A;  2UY0_B;  2PYN_A;  2PYN_B;  3KFS_A;  3KFS_B;  6OXU_A;  6OXU_B;  2HPE_A;  2HPE_B;  3KDD_A;  3KDD_B;  5T8H_A;  5T8H_B;  4NKK_A;  3GGU_A;  3GGU_B;  2Q55_A;  2Q55_B;  2QMP_A;  2QMP_B;  6DH3_A;  6DH3_B;  3KFN_A;  3KFN_B;  3KF0_A;  3KF0_B;  6D0D_A;  6D0D_B;  2AID_A;  2AID_B;  6DH8_A;  6DH8_B;  1FEJ_C;  1FEJ_D;  5E5J_A;  5E5J_B;  3MXD_A;  3MXD_B;  1B6M_A;  1B6M_B;  3O9A_A;  3O9A_B;  5YRS_A;  5YRS_B;  1IZH_A;  1IZH_B;  2I0D_A;  2I0D_B;  3R4B_A;  3R4B_B;  3S56_A;  3S56_B;  6OXY_A;  6OXY_B;  4Q1X_A;  4Q1X_B;  5COK_A;  5COK_B;  6DH0_A;  6DH0_B;  3BGB_A;  3BGB_B;  1HVJ_A;  1HVJ_B;  2QI1_A;  2QI1_B;  2FNS_A;  2FNS_B;  2R3W_A;  2R3W_B;  4DQF_A;  4DQF_B;  3NU9_A;  3NU9_B;  1FF0_C;  1FF0_D;  4EJK_A;  4EJK_B;  6C8Y_A;  6C8Y_B;  1MER_A;  1MER_B;  1AJX_A;  1AJX_B;  1W5Y_A;  1W5Y_B;  6OXT_A;  6OXT_B;  3OXW_A;  3OXW_B;  3OXW_C;  3OXW_D;  4QGI_A;  4QGI_B;  1MES_A;  1MES_B;  2QI3_A;  2QI3_B;  6OPV_A;  6OPV_B;  3SAA_A;  3SAA_B;  2NXL_A;  2NXL_B;  6OXZ_A;  6OXZ_B;  1FG6_C;  1FG6_D;  3KFP_A;  6OXP_A;  6OXP_B;  1HPV_A;  1HPV_B;  1ODX_A;  1ODX_B;  1HSG_A;  1HSG_B;  3O99_A;  3O99_B;  1D4Y_A;  1D4Y_B;  6OXQ_A;  6OXQ_B;  1MEU_A;  1MEU_B;  1ODY_A;  1ODY_B;  5CON_A;  5CON_B;  4A6B_A;  4A6B_B;  2XYF_A;  2XYF_B;  1HSH_A;  1HSH_B;  1HSH_C;  1HSH_D;  4DQC_A;  4DQC_B;  1B6K_A;  1B6K_B;  1MET_A;  1MET_B;  2PYM_A;  2PYM_B;  1HIV_A;  1HIV_B;  6DH7_A;  6DH7_B;  6DH6_A;  6DH6_B;  1HPX_A;  1HPX_B;  3JVW_A;  3JVW_B;  2BPY_A;  2BPY_B;  1D4K_A;  1D4K_B;  4LL3_A;  4LL3_B;  6DH4_A;  6DH4_B;  1BWA_A;  1BWA_B;  4OBD_A;  4OBD_B;  4OBD_C;  4OBD_D;  1A8K_A;  1A8K_B;  1A8K_D;  1A8K_E;  4L1A_A;  4L1A_B;  6OPT_A;  6OPT_B;  1MT7_A;  1MT7_B;  1CPI_A;  1CPI_B;  4QJ8_A;  4QJ8_B;  4QJ8_C;  4QJ8_D;  5HVP_A;  5HVP_B;  5COO_A;  5COO_B;  6OXV_A;  6OXV_B;  1EC3_A;  1EC3_B;  1W5X_A;  1W5X_B;  1K6V_A;  1K6V_B;  3EKX_A;  3EKX_B;  1MT9_A;  1MT9_B;  2FGU_A;  2FGU_B;  3NWX_A;  3NWX_B;  1RPI_A;  1RPI_B;  2BPV_A;  2BPV_B;  4UPJ_A;  4UPJ_B;  4RVX_A;  4RVX_B;  4RVX_C;  4RVX_D;  6OY1_A;  6OY1_B;  2FLE_A;  2FLE_B;  4HLA_A;  4HLA_B;  6OY0_A;  6OY0_B;  2Q5K_A;  2Q5K_B;  1A94_A;  1A94_B;  1A94_D;  1A94_E;  1FG8_C;  1FG8_D;  1NPA_A;  1NPA_B;  6DGY_A;  6DGY_B;  1ZBG_A;  1ZBG_B;  4FE6_A;  1KJG_A;  1KJG_B;  5V4Y_A;  6OXX_A;  6OXX_B;  4I8W_A;  4I8W_B;  1B6P_A;  1B6P_B;  1EBZ_A;  1EBZ_B;  1FGC_C;  1FGC_D;  1FFF_C;  1FFF_D;  6OXS_A;  6OXS_B;  1DW6_C;  1DW6_D;  6OXW_A;  6OXW_B;  6DH1_A;  6DH1_B;  6DGZ_A;  6DGZ_B;  1AJV_A;  1AJV_B;  6D0E_A;  6D0E_B;  1G2K_A;  1G2K_B;  6DH2_A;  6DH2_B;  6DH5_A;  6DH5_B;  1NPW_A;  1NPW_B;  1KJH_A;  1KJH_B;  3TLH_A;  2WL0_A;  2WL0_B;  2P3B_A;  2P3B_B;  1ODW_A;  1ODW_B;  4NJT_A;  4NJT_B;  4NJT_C;  4NJT_D;  2Q3K_A;  2Q3K_B;  2O4N_A;  2O4N_B;  1A30_A;  1A30_B;  4U7Q_A;  4U7Q_B;  1HIH_A;  1HIH_B;  3EL4_A;  3EL4_B;  1HTG_A;  1HTG_B;  3LZS_A;  3LZS_B;  6OY2_A;  6OY2_B;  1SGU_A;  1SGU_B;  1WBK_A;  1WBK_B;  6OPU_A;  6OPU_B;  6DGX_A;  6DGX_B;  1AXA_A;  1AXA_B;  1TSQ_A;  1TSQ_B;  1BV7_A;  1BV7_B;  4JEC_A;  4JEC_B;  2CEM_A;  2CEM_B;  2QI0_A;  2QI0_B;  1F7A_A;  1F7A_B;  2NXD_A;  2NXD_B;  1BV9_A;  1BV9_B;  5TYS_A;  5TYS_B;  3OUC_A;  3OUC_B;  6OXR_A;  6OXR_B;  3EL0_A;  3EL0_B;  4FAF_A;  4FAF_B;  1ZP8_A;  1ZPA_A;  1KJF_A;  1KJF_B;  1HII_A;  1HII_B;  3EKT_A;  3EKT_B;  3EKT_C;  3EKT_D;  4PHV_A;  4PHV_B;  6OXO_A;  6OXO_B;  1AZ5_A;  1HEF_E;  5COP_A;  5COP_B;  1HVS_A;  1HVS_B;  1KJ7_A;  1KJ7_B;  3PSU_A;  3U7S_A;  3U7S_B;  1EBK_C;  1EBK_D;  1EBK_E;  1EBK_F;  3EM4_A;  3EM4_B;  3EM4_U;  3EM4_V;  1MRX_A;  1MRX_B;  3T3C_A;  3T3C_B;  7UPJ_A;  7UPJ_B;  1ZSR_A;  1ZSR_B;  1MSM_A;  1MSM_B;  1EC2_A;  1EC2_B;  1NPV_A;  1NPV_B;  1DMP_A;  1DMP_B;  1ZJ7_A;  4GZF_A;  4GZF_B;  3EM6_A;  3EM6_B;  4F74_A;  4F74_B;  1ZTZ_A;  1ZTZ_B;  1QBT_A;  1QBT_B;  4M8X_A;  4M8X_B;  1ZSF_A;  1ZSF_B;  4QJ2_A;  4QJ2_B;  4QJ2_C;  4QJ2_D;  1WBM_A;  1WBM_B;  5VEA_A;  1MRW_A;  1MRW_B;  3LZV_A;  3LZV_B;  1AID_A;  1AID_B;  2XYE_A;  2XYE_B;  2MIP_A;  2MIP_B;  2MIP_C;  2MIP_D;  1MSN_A;  1MSN_B;  5VJ3_A;  1OHR_A;  1OHR_B;  2P3C_A;  2P3C_B;  3KDC_A;  3KDC_B;  1IDB_A;  1IDB_B;  1RL8_A;  1RL8_B;  2AZB_A;  1IZI_A;  1IZI_B;  2AQU_A;  2AQU_B;  1EC1_A;  1EC1_B;  1K6P_A;  1K6P_B;  2BQV_A;  2BQV_B;  7HVP_A;  7HVP_B;  2AZC_A;  2AZC_B;  1TSU_A;  1TSU_B;  4RVI_A;  4RVI_B;  4RVI_C;  4RVI_D;  1HEG_E;  4TVH_A;  4TVH_B;  6OPY_A;  6OPY_B;  3EM3_A;  3EM3_B;  6UPJ_A;  6UPJ_B;  3EKP_A;  3EKP_B;  3EKP_C;  3EKP_D;  2AZ8_A;  1SIP_A;  1Z8C_A;  1Z8C_B;  3T11_A;  3T11_B;  2Q63_A;  2Q63_B;  6OOU_A;  6OOU_B;  8HVP_A;  8HVP_B;  1HTF_A;  1HTF_B;  1GNO_A;  1GNO_B;  1K6C_A;  1K6C_B;  1K6T_A;  1K6T_B;  1GNM_A;  1GNM_B;  4TVG_A;  4TVG_B;  4HVP_A;  4HVP_B;  1HBV_A;  1HBV_B;  3EKQ_A;  3EKQ_B;  1UPJ_A;  1MT8_A;  1MT8_B;  1YTH_A;  1YTH_B;  1YTG_A;  1YTG_B;  6OPS_A;  6OPS_B;  1TCX_A;  1TCX_B;  2NXM_A;  2NXM_B;  1K2C_A;  1K2C_B;  5UPJ_A;  5UPJ_B;  1T7J_A;  1T7J_B;  1GNN_A;  1GNN_B;  1EBY_A;  1EBY_B;  1HXB_A;  1HXB_B;  1A8G_A;  1A8G_B;  1A9M_A;  1A9M_B;  2QAK_A;  2QAK_B;  4M8Y_A;  4M8Y_B;  1HOS_A;  1HOS_B;  3TTP_A;  3TTP_B;  4CPU_A;  4CPU_B;  1SBG_A;  1SBG_B;  1LZQ_A;  1LZQ_B;  2B7Z_A;  2B7Z_B;  4K4P_A;  4K4P_B;  6OPX_A;  6OPX_B;  4GYE_A;  4GYE_B;  1YTI_A;  1U8G_A;  1U8G_B;  1HPS_A;  1HPS_B;  3OQA_A;  1C70_A;  1C70_B;  5KQX_A;  5KQX_B;  1VIJ_A;  1VIJ_B;  1VIK_A;  1VIK_B;  2B60_A;  2B60_B;  1HSI_A;  1HSI_B;  4EJ8_A;  4EJ8_B;  1N49_A;  1N49_B;  1N49_C;  1N49_D;  4FAE_A;  4FAE_B;  4CPX_A;  4CPX_B;  2Z54_A;  2Z54_B;  2QNQ_A;  2QNQ_B;  4COE_A;  4COE_B;  2BPZ_A;  2BPZ_B;  2A4F_A;  2A4F_B;  3UPJ_A;  3UPJ_B;  1ZLF_A;  1ZLF_B;  1M0B_A;  1M0B_B;  2HB4_A;  2SAM_A;  1YTJ_A;  3UHL_A;  3UHL_B;  3UHL_C;  3UHL_D;  2R5P_A;  2R5P_B;  2R5P_C;  2R5P_D;  1D4S_A;  1D4S_B;  1JLD_A;  1JLD_B;  1HPO_A;  1HPO_B;  1C6Y_A;  1C6Y_B;  1C6Z_A;  1C6Z_B;  3AID_A;  3AID_B;  1TCW_A;  1TCW_B;  2Q64_A;  2Q64_B;  6OPZ_A;  6OPZ_B;  4EJL_A;  4EJL_B;  6OPW_A;  6OPW_B;  1SIV_A;  1SIV_B;  1AAQ_A;  1AAQ_B;  1MTB_A;  1MTB_B;  1BDQ_A;  1BDQ_B;  1IVP_A;  1IVP_B;  1C6X_A;  1C6X_B;  3PJ6_A;  1IVQ_A;  1IVQ_B;  1FB7_A;  1HTE_A;  1HTE_B;  4CPQ_A;  4CPQ_B;  2BPW_A;  2BPW_B;  2UPJ_A;  2UPJ_B;  2HPF_A;  2HPF_B;  1SH9_A;  1SH9_B;  2BPX_A;  2BPX_B;  2R5Q_A;  2R5Q_B;  2R5Q_C;  2R5Q_D;  1HHP_A;  9HVP_A;  9HVP_B;  3PHV_A;  3HVP_A;  3GGA_A;  3GGA_B;  3GGA_C;  3GGA_D;  3GGA_G;  3GGA_H;  2P3D_A;  2P3D_B;  2FDE_A;  2FDE_B;  2CEJ_A;  2CEJ_B;  2QHC_A;  2QHC_B;  3GGX_A;  3GGX_B;  3GGX_C;  3GGX_D;  3GGX_E;  3GGX_F;  3GGX_G;  3GGX_H;  4DQG_A;  4DQG_B;  1BDL_A;  1BDL_B;  1BDR_A;  1BDR_B;  3D3T_A;  3D3T_B;  2AZ9_A;  3U71_A;  1KJ4_A;  1KJ4_B;  1KJ4_C;  1KJ4_D;  2HB2_A;  1FQX_A;  1FQX_B;  1RQ9_A;  1RQ9_B;  3SO9_A;  3SO9_B;  3S85_A;  3S85_B;  3S85_C;  3S85_D;  3S85_E;  3S85_F;  3S85_G;  3S85_H;  3S85_I;  3S85_J;  3S85_K;  3S85_L;  3GGV_A;  3GGV_B;  3GGV_C;  3GGV_D;  3GGV_E;  3GGV_F;  3GGV_G;  3GGV_H;  3GGV_I;  1RV7_A;  1RV7_B;  5W5W_A;  5W5W_B;  1YT9_A;  1YT9_B;  1T7K_A;  1T7K_B;  1MUI_A;  1MUI_B;  2ZYE_A;  2ZYE_B;  1Q9P_A;  1BVE_A;  1BVE_B;  1BVG_A;  1BVG_B;  2HVP_A;  5YOK_A;  5YOK_B;  2HS1_A;  2HS1_B;  3A2O_A;  3A2O_B;  3FX5_A;  3FX5_B;  2NMZ_A;  2NMZ_B;  6IXD_A;  6IXD_B;  3NU3_A;  3NU3_B;  3DJK_A;  3DJK_B;  1NH0_A;  1NH0_B;  3NDX_A;  3NDX_B;  2J9J_A;  2J9J_B;  2AVS_A;  2AVS_B;  2AVM_A;  2AVM_B;  3D20_A;  3D20_B;  3D1Y_A;  3D1Y_B;  2AVO_A;  2AVO_B;  3D1X_A;  3D1X_B;  3BVA_A;  3BVA_B;  4HE9_A;  4HE9_B;  2IDW_A;  2IDW_B;  2JE4_A;  2JE4_B;  3DK1_A;  3DK1_B;  2AOG_A;  2AOG_B;  2QD7_A;  2QD7_B;  4ZIP_A;  4ZIP_B;  1KZK_A;  1KZK_B;  2NMY_A;  2NMY_B;  6U7P_A;  6U7P_B;  4EJD_A;  4EJD_B;  3MWS_A;  3MWS_B;  6CDJ_A;  6CDJ_B;  3NDW_A;  3NDW_B;  6BRA_A;  6BRA_B;  3OXC_A;  3OXC_B;  3TOH_A;  3TOH_B;  3NU6_A;  3NU6_B;  3ECG_A;  3ECG_B;  6DV4_A;  6DV4_B;  5JG1_A;  5JG1_B;  3EBZ_A;  3EBZ_B;  2F8G_A;  2F8G_B;  1T3R_A;  1T3R_B;  3I6O_A;  3I6O_B;  2R8N_A;  3EC0_A;  3EC0_B;  4FL8_A;  4FL8_B;  2NNP_A;  2NNP_B;  5IVT_A;  5IVT_B;  6DV0_A;  6DV0_B;  3CYX_A;  3CYX_B;  2HS2_A;  2HS2_B;  6O54_X;  6DIF_A;  6DIF_B;  2QCI_A;  2QCI_B;  6PRF_A;  6PRF_B;  3NU4_A;  3NU4_B;  4DFG_A;  4DFG_B;  3NDU_A;  3NDU_B;  3NDU_C;  3NDU_D;  6E9A_A;  6E9A_B;  5DGU_A;  5DGU_B;  2F81_A;  2F81_B;  1SDU_A;  1SDU_B;  2AVQ_A;  2AVQ_B;  2NNK_A;  2NNK_B;  4HDP_A;  4HDP_B;  3VF5_A;  3VF5_B;  4MC9_A;  4MC9_B;  6CDL_A;  6CDL_B;  2AOC_A;  2AOC_B;  2J9K_A;  2J9K_B;  5UPZ_A;  5UPZ_B;  3OK9_A;  3OK9_B;  1K1T_A;  1K1T_B;  4KB9_A;  4KB9_B;  3S43_A;  3S43_B;  3H5B_A;  3H5B_B;  3SPK_A;  3SPK_B;  5AGZ_A;  5AGZ_B;  5WLO_A;  5WLO_B;  1TW7_A;  1TW7_B;  2AOF_A;  2AOF_B;  2QD6_A;  2QD6_B;  3NU5_A;  3NU5_B;  6DJ1_A;  6DJ1_B;  6E7J_A;  6E7J_B;  3D1Z_A;  3D1Z_B;  4FLG_A;  4FLG_B;  6B4N_A;  6B4N_B;  1SDT_A;  1SDT_B;  4U8W_A;  4U8W_B;  2A1E_A;  2A1E_B;  3VF7_A;  3VF7_B;  6U7O_A;  6U7O_B;  4HDF_A;  4HDF_B;  4YHQ_A;  4YHQ_B;  2QD8_A;  2QD8_B;  3BVB_A;  3BVB_B;  5BS4_A;  5BS4_B;  6DJ7_A;  6DJ7_B;  5UOV_A;  5UOV_B;  4J55_A;  4J55_B;  3NUO_A;  3NUO_B;  3TL9_A;  3TL9_B;  2HB3_A;  2HB3_B;  3IA9_A;  3IA9_B;  3HAU_A;  3HAU_B;  6DJ2_A;  6DJ2_B;  5AH8_A;  5AH8_B;  3KFR_A;  3KFR_B;  4MC6_A;  4MC6_B;  3HAW_A;  3HAW_B;  4YE3_A;  4YE3_B;  2G69_A;  5BRY_A;  5BRY_B;  1T7I_A;  1T7I_B;  2HC0_A;  2HC0_B;  3TKG_A;  3TKG_B;  3TKG_C;  3TKG_D;  3QN8_A;  3QN8_B;  2IEN_A;  2IEN_B;  3QIH_A;  3QIH_B;  3TH9_A;  3TH9_B;  4DQE_A;  4DQE_B;  3TOG_A;  3TOG_B;  3TOG_C;  3TOG_D;  3K4V_A;  3K4V_B;  3K4V_C;  3K4V_D;  2AOD_A;  2AOD_B;  3UCB_A;  3UCB_B;  2PC0_A;  2O4L_A;  2O4L_B;  2AOI_A;  2AOI_B;  1SDV_A;  1SDV_B;  3S54_A;  3S54_B;  4Z50_A;  4Z50_B;  4Z50_C;  4Z50_D;  3CYW_A;  3CYW_B;  3PWM_A;  3PWM_B;  3PWR_A;  3PWR_B;  4FM6_A;  4FM6_B;  3QAA_A;  3QAA_B;  2F80_A;  2F80_B;  4DJP_A;  4DJP_B;  3QP0_A;  3QP0_B;  4MC1_A;  4MC1_B;  4DJQ_A;  4DJQ_B;  3ST5_A;  3ST5_B;  6OTG_A;  6OTG_B;  3B7V_A;  3B7V_B;  2QNP_A;  2QNP_B;  5AHA_A;  5AHA_B;  3VFA_A;  3VFA_B;  2AVV_A;  2AVV_B;  2AVV_D;  2AVV_E;  5T2E_A;  4HEG_A;  4HEG_B;  2AOH_A;  2AOH_B;  5T2Z_A;  5T2Z_B;  3O9I_A;  3O9I_B;  2AOE_A;  2AOE_B;  3NUJ_A;  3NUJ_B;  3UFN_A;  3UFN_B;  4HDB_A;  4HDB_B;  4U7V_A;  4U7V_B;  3B80_A;  3B80_B;  3QBF_A;  3QBF_B;  3DCR_A;  3DCR_B;  6DIL_A;  6DIL_B;  2IEO_A;  2IEO_B;  2FNT_A;  2FNT_B;  2QNN_A;  2QNN_B;  4NPU_A;  4NPU_B;  2BB9_A;  2BB9_B;  3TOF_A;  3TOF_B;  6MCR_A;  3NYG_A;  3NYG_B;  6B3F_A;  6B3F_B;  3SA8_A;  3SA8_B;  5IVS_A;  5IVS_B;  5AH9_A;  5AH9_B;  3O9B_A;  3O9B_B;  3O9E_A;  3O9E_B;  2PWR_A;  2PWR_B;  6O48_A;  6O48_B;  4QJA_A;  4QJA_B;  4DQB_A;  4DQB_B;  5YOJ_A;  5YOJ_B;  2FGV_A;  2FGV_B;  4QJ6_A;  4QJ6_B;  4QJ6_C;  4QJ6_D;  6B38_A;  6B38_B;  4YOB_A;  3VFB_A;  3VFB_B;  3SAC_A;  3SAC_B;  1XL2_A;  1XL2_B;  4Q1Y_A;  4Q1Y_B;  2PK6_A;  2PK6_B;  2AOJ_A;  2AOJ_B;  2Z4O_A;  2Z4O_B;  2PQZ_A;  2PQZ_B;  6B3G_A;  6B3G_B;  3S45_A;  3S45_B;  5ULT_A;  5ULT_B;  3TKW_A;  3TKW_B;  3NWQ_A;  3NWQ_B;  4DJR_A;  4DJR_B;  5IVR_A;  5IVR_B;  3SAB_A;  3SAB_B;  5AHB_A;  5AHB_B;  3SA7_A;  3SA7_B;  4CPS_A;  4CPS_B;  5AH6_A;  5AH6_B;  2O4S_A;  2O4S_B;  3I2L_A;  3I2L_B;  3S53_A;  3S53_B;  2R43_A;  2R43_B;  2F3K_A;  2F3K_B;  1D4I_A;  1D4I_B;  5AHC_A;  5AHC_B;  3ZPS_A;  3ZPS_B;  5JFP_A;  5JFP_B;  4E43_A;  4E43_B;  4RVJ_A;  4RVJ_B;  4RVJ_C;  4RVJ_D;  1K1U_A;  1K1U_B;  3QPJ_A;  3QPJ_B;  6MCS_A;  3BXS_A;  3BXS_B;  2I4V_A;  2I4V_B;  1ZPK_A;  1ZPK_B;  2I4U_A;  2I4U_B;  3BXR_A;  3BXR_B;  6C8X_A;  6C8X_B;  4J54_A;  4J54_B;  4ZLS_A;  4ZLS_B;  5IVQ_A;  5IVQ_B;  6B3C_A;  6B3C_B;  3QRO_A;  3QRO_B;  3NDT_A;  3NDT_B;  3NDT_C;  3NDT_D;  4MC2_A;  4MC2_B;  3JVY_A;  6B3H_A;  6B3H_B;  2O4K_A;  2O4K_B;  4A6C_A;  4A6C_B;  3EKW_A;  3EKW_B;  5KR1_A;  5KR1_B;  3SA3_A;  3SA3_B;  1DAZ_C;  1DAZ_D;  3OXX_A;  3OXX_B;  3OXX_C;  3OXX_D;  3OUB_A;  3OUB_B;  3EL9_A;  3EL9_B;  5AH7_A;  5AH7_B;  6B36_A;  6B36_B;  5UFZ_A;  5UFZ_B;  3SA5_A;  3SA5_B;  3O9G_A;  3O9G_B;  3OU4_A;  3OU4_B;  5T84_A;  5T84_B;  3EL5_A;  3EL5_B;  4OBJ_A;  4OBJ_B;  2I4D_A;  2I4D_B;  3ZPT_A;  3ZPT_B;  4OBK_A;  4OBK_B;  3UF3_A;  3UF3_B;  5KQY_A;  5KQY_B;  6O5A_A;  6O5A_B;  2I4W_A;  2I4W_B;  3CKT_A;  3CKT_B;  6MK9_A;  6MK9_B;  3O9H_A;  3O9H_B;  6MKL_A;  6MKL_B;  3O9F_A;  3O9F_B;  4QJ7_A;  4QJ7_B;  4QJ7_C;  4QJ7_D;  4F75_A;  4F75_B;  4CPW_A;  4CPW_B;  5DGW_A;  5DGW_B;  2FDD_A;  2FDD_B;  3QRS_A;  3QRS_B;  4OBF_A;  4OBF_B;  4OBF_C;  4OBF_D;  4CPT_A;  4CPT_B;  3SA9_A;  3SA9_B;  4NPT_A;  6O5X_A;  6O5X_B;  6O5X_C;  6O5X_D;  3I8W_A;  3EL1_A;  3EL1_B;  3NLS_A;  3NLS_B;  3R0Y_A;  3R0Y_B;  3QRM_A;  3QRM_B;  5KQZ_A;  5KQZ_B;  2PSV_A;  2PSV_B;  2I4X_A;  2I4X_B;  3SA6_A;  3SA6_B;  3OXV_A;  3OXV_B;  3OXV_C;  3OXV_D;  6BZ2_A;  6BZ2_B;  4DJO_A;  4DJO_B;  3OUA_A;  3OUA_B;  2PWC_A;  2PWC_B;  4YOA_A;  3OTS_A;  3OTS_B;  2I0A_A;  2I0A_B;  3OU3_A;  3OU3_B;  1MTR_A;  1MTR_B;  1IDA_A;  1IDA_B;  1DIF_A;  1DIF_B;  2NPH_A;  2NPH_B;  2FXD_A;  2FXD_B;  4I8Z_A;  4I8Z_B;  3OQ7_A;  3KDB_A;  3KDB_B;  3R0W_A;  3R0W_B;  3OY4_A;  3OY4_B;  3OQD_A;  4QJ9_A;  4QJ9_B;  2P3A_A;  2P3A_B;  4DQH_A;  4DQH_B;  3HBO_A;  3HBO_B;  4Z4X_A;  4Z4X_B;  6O57_A;  6O57_B;  3GI5_A;  3GI5_B;  4GB2_A;  4GB2_B;  3OTY_A;  3OTY_B;  3IXO_A;  3IXO_B;  1IIQ_A;  1IIQ_B;  1D4L_A;  1D4L_B;  3EKV_A;  3EKV_B;  2QI4_A;  2QI4_B;  2ZGA_A;  5VCK_A;  5VCK_B;  4CPR_A;  4CPR_B;  4CP7_A;  4CP7_B;  2QHY_A;  2QHY_B;  1HVK_A;  1HVK_B;  3EKY_A;  3EKY_B;  3SA4_A;  3SA4_B;  1SP5_A;  1SP5_B;  3GI6_A;  3GI6_B;  2R3T_A;  2R3T_B;  1XL5_A;  1XL5_B;  3BHE_A;  3BHE_B;  4OBH_A;  4OBH_B;  4OBH_C;  4OBH_D;  1FFI_C;  1FFI_D;  5KR0_A;  5KR0_B;  1HVI_A;  1HVI_B;  1K2B_A;  1K2B_B;  2QHZ_A;  2QHZ_B;  3I7E_A;  3I7E_B;  3ZPU_A;  3ZPU_B;  4F76_A;  4F76_B;  4NJS_A;  4NJS_B;  4NJS_C;  4NJS_D;  2BBB_A;  2BBB_B;  6DJ5_A;  6DJ5_B;  3BGC_A;  3BGC_B;  1PRO_A;  1PRO_B;  3LZU_A;  3LZU_B;  5KAO_A;  5KAO_B;  2R38_A;  2R38_B;  4NJU_A;  4NJU_B;  4NJU_C;  4NJU_D;  1HVL_A;  1HVL_B;  2UXZ_A;  2UXZ_B;  1B6L_A;  1B6L_B;  5KR2_A;  5KR2_B;  5KR2_C;  5KR2_D;  3GI4_A;  3GI4_B;  5E5K_A;  5E5K_B;  2QI6_A;  2QI6_B;  1EC0_A;  1EC0_B;  1HVH_A;  1HVH_B;  2CEN_A;  2CEN_B;  4NJV_A;  4NJV_B;  4NJV_C;  4NJV_D;  1W5V_A;  1W5V_B;  1W5W_A;  1W5W_B;  1QBS_A;  1QBS_B;  4Q1W_A;  4Q1W_B;  2QI5_A;  2QI5_B;  3M9F_A;  3M9F_B;  3HDK_A;  3HDK_B;  1HWR_A;  1HWR_B;  1QBR_A;  1QBR_B;  1QBU_A;  1QBU_B;  1B6J_A;  1B6J_B;  4J5J_A;  4J5J_B;  2QI7_A;  2QI7_B;  2Q54_A;  2Q54_B;  3O9D_A;  3O9D_B;  3O9C_A;  3O9C_B;  3OU1_A;  3OU1_B;  1HVR_A;  1HVR_B;  5TYR_A;  5TYR_B;  2PK5_A;  2PK5_B;  4EYR_A;  4EYR_B;  2RKF_A;  2RKF_B;  1Z1R_A;  1Z1R_B;  1EBW_A;  1EBW_B;  6OOS_A;  6OOS_B;  6OOS_C;  6OOS_D;  3BC4_A;  1G35_A;  1G35_B;  3OUD_A;  3OUD_B;  5B18_A;  5B18_B;  5B18_C;  5B18_D;  5JFU_A;  5JFU_B;  2RKG_A;  2RKG_B;  3DCK_A;  3DCK_B;  2WKZ_A;  2WKZ_B;  3JW2_A;  3JW2_B;  4OBG_A;  4OBG_B;  4OBG_C;  4OBG_D;  4K4R_A;  4K4R_B;  4K4Q_A;  4K4Q_B;  1Z1H_A;  1Z1H_B;  3MXE_A;  3MXE_B;  1D4H_A;  1D4H_B;  1BWB_A;  1BWB_B;  4F73_A;  4F73_B;  2PSU_A;  2PSU_B;  4A4Q_A;  4A4Q_B;  1HXW_A;  1HXW_B;  2FXE_A;  2FXE_B;  1D4J_A;  1D4J_B;  2O4P_A;  2O4P_B;  6OOT_A;  6OOT_B;  2UY0_A;  2UY0_B;  2PYN_A;  2PYN_B;  3KFS_A;  3KFS_B;  6OXU_A;  6OXU_B;  2HPE_A;  2HPE_B;  3KDD_A;  3KDD_B;  5T8H_A;  5T8H_B;  4NKK_A;  3GGU_A;  3GGU_B;  2Q55_A;  2Q55_B;  2QMP_A;  2QMP_B;  6DH3_A;  6DH3_B;  3KFN_A;  3KFN_B;  3KF0_A;  3KF0_B;  6D0D_A;  6D0D_B;  2AID_A;  2AID_B;  6DH8_A;  6DH8_B;  1FEJ_C;  1FEJ_D;  5E5J_A;  5E5J_B;  3MXD_A;  3MXD_B;  1B6M_A;  1B6M_B;  3O9A_A;  3O9A_B;  5YRS_A;  5YRS_B;  1IZH_A;  1IZH_B;  2I0D_A;  2I0D_B;  3R4B_A;  3R4B_B;  3S56_A;  3S56_B;  6OXY_A;  6OXY_B;  4Q1X_A;  4Q1X_B;  5COK_A;  5COK_B;  6DH0_A;  6DH0_B;  3BGB_A;  3BGB_B;  1HVJ_A;  1HVJ_B;  2QI1_A;  2QI1_B;  2FNS_A;  2FNS_B;  2R3W_A;  2R3W_B;  4DQF_A;  4DQF_B;  3NU9_A;  3NU9_B;  1FF0_C;  1FF0_D;  4EJK_A;  4EJK_B;  6C8Y_A;  6C8Y_B;  1MER_A;  1MER_B;  1AJX_A;  1AJX_B;  1W5Y_A;  1W5Y_B;  6OXT_A;  6OXT_B;  3OXW_A;  3OXW_B;  3OXW_C;  3OXW_D;  4QGI_A;  4QGI_B;  1MES_A;  1MES_B;  2QI3_A;  2QI3_B;  6OPV_A;  6OPV_B;  3SAA_A;  3SAA_B;  2NXL_A;  2NXL_B;  6OXZ_A;  6OXZ_B;  1FG6_C;  1FG6_D;  3KFP_A;  6OXP_A;  6OXP_B;  1HPV_A;  1HPV_B;  1ODX_A;  1ODX_B;  1HSG_A;  1HSG_B;  3O99_A;  3O99_B;  1D4Y_A;  1D4Y_B;  6OXQ_A;  6OXQ_B;  1MEU_A;  1MEU_B;  1ODY_A;  1ODY_B;  5CON_A;  5CON_B;  4A6B_A;  4A6B_B;  2XYF_A;  2XYF_B;  1HSH_A;  1HSH_B;  1HSH_C;  1HSH_D;  4DQC_A;  4DQC_B;  1B6K_A;  1B6K_B;  1MET_A;  1MET_B;  2PYM_A;  2PYM_B;  1HIV_A;  1HIV_B;  6DH7_A;  6DH7_B;  6DH6_A;  6DH6_B;  1HPX_A;  1HPX_B;  3JVW_A;  3JVW_B;  2BPY_A;  2BPY_B;  1D4K_A;  1D4K_B;  4LL3_A;  4LL3_B;  6DH4_A;  6DH4_B;  1BWA_A;  1BWA_B;  4OBD_A;  4OBD_B;  4OBD_C;  4OBD_D;  1A8K_A;  1A8K_B;  1A8K_D;  1A8K_E;  4L1A_A;  4L1A_B;  6OPT_A;  6OPT_B;  1MT7_A;  1MT7_B;  1CPI_A;  1CPI_B;  4QJ8_A;  4QJ8_B;  4QJ8_C;  4QJ8_D;  5HVP_A;  5HVP_B;  5COO_A;  5COO_B;  6OXV_A;  6OXV_B;  1EC3_A;  1EC3_B;  1W5X_A;  1W5X_B;  1K6V_A;  1K6V_B;  3EKX_A;  3EKX_B;  1MT9_A;  1MT9_B;  2FGU_A;  2FGU_B;  3NWX_A;  3NWX_B;  1RPI_A;  1RPI_B;  2BPV_A;  2BPV_B;  4UPJ_A;  4UPJ_B;  4RVX_A;  4RVX_B;  4RVX_C;  4RVX_D;  6OY1_A;  6OY1_B;  2FLE_A;  2FLE_B;  4HLA_A;  4HLA_B;  6OY0_A;  6OY0_B;  2Q5K_A;  2Q5K_B;  1A94_A;  1A94_B;  1A94_D;  1A94_E;  1FG8_C;  1FG8_D;  1NPA_A;  1NPA_B;  6DGY_A;  6DGY_B;  1ZBG_A;  1ZBG_B;  4FE6_A;  1KJG_A;  1KJG_B;  5V4Y_A;  6OXX_A;  6OXX_B;  4I8W_A;  4I8W_B;  1B6P_A;  1B6P_B;  1EBZ_A;  1EBZ_B;  1FGC_C;  1FGC_D;  1FFF_C;  1FFF_D;  6OXS_A;  6OXS_B;  1DW6_C;  1DW6_D;  6OXW_A;  6OXW_B;  6DH1_A;  6DH1_B;  6DGZ_A;  6DGZ_B;  1AJV_A;  1AJV_B;  6D0E_A;  6D0E_B;  1G2K_A;  1G2K_B;  6DH2_A;  6DH2_B;  6DH5_A;  6DH5_B;  1NPW_A;  1NPW_B;  1KJH_A;  1KJH_B;  3TLH_A;  2WL0_A;  2WL0_B;  2P3B_A;  2P3B_B;  1ODW_A;  1ODW_B;  4NJT_A;  4NJT_B;  4NJT_C;  4NJT_D;  2Q3K_A;  2Q3K_B;  2O4N_A;  2O4N_B;  1A30_A;  1A30_B;  4U7Q_A;  4U7Q_B;  1HIH_A;  1HIH_B;  3EL4_A;  3EL4_B;  1HTG_A;  1HTG_B;  3LZS_A;  3LZS_B;  6OY2_A;  6OY2_B;  1SGU_A;  1SGU_B;  1WBK_A;  1WBK_B;  6OPU_A;  6OPU_B;  6DGX_A;  6DGX_B;  1AXA_A;  1AXA_B;  1TSQ_A;  1TSQ_B;  1BV7_A;  1BV7_B;  4JEC_A;  4JEC_B;  2CEM_A;  2CEM_B;  2QI0_A;  2QI0_B;  1F7A_A;  1F7A_B;  2NXD_A;  2NXD_B;  1BV9_A;  1BV9_B;  5TYS_A;  5TYS_B;  3OUC_A;  3OUC_B;  6OXR_A;  6OXR_B;  3EL0_A;  3EL0_B;  4FAF_A;  4FAF_B;  1ZP8_A;  1ZPA_A;  1KJF_A;  1KJF_B;  1HII_A;  1HII_B;  3EKT_A;  3EKT_B;  3EKT_C;  3EKT_D;  4PHV_A;  4PHV_B;  6OXO_A;  6OXO_B;  1AZ5_A;  1HEF_E;  5COP_A;  5COP_B;  1HVS_A;  1HVS_B;  1KJ7_A;  1KJ7_B;  3PSU_A;  3U7S_A;  3U7S_B;  1EBK_C;  1EBK_D;  1EBK_E;  1EBK_F;  3EM4_A;  3EM4_B;  3EM4_U;  3EM4_V;  1MRX_A;  1MRX_B;  3T3C_A;  3T3C_B;  7UPJ_A;  7UPJ_B;  1ZSR_A;  1ZSR_B;  1MSM_A;  1MSM_B;  1EC2_A;  1EC2_B;  1NPV_A;  1NPV_B;  1DMP_A;  1DMP_B;  1ZJ7_A;  4GZF_A;  4GZF_B;  3EM6_A;  3EM6_B;  4F74_A;  4F74_B;  1ZTZ_A;  1ZTZ_B;  1QBT_A;  1QBT_B;  4M8X_A;  4M8X_B;  1ZSF_A;  1ZSF_B;  4QJ2_A;  4QJ2_B;  4QJ2_C;  4QJ2_D;  1WBM_A;  1WBM_B;  5VEA_A;  1MRW_A;  1MRW_B;  3LZV_A;  3LZV_B;  1AID_A;  1AID_B;  2XYE_A;  2XYE_B;  2MIP_A;  2MIP_B;  2MIP_C;  2MIP_D;  1MSN_A;  1MSN_B;  5VJ3_A;  1OHR_A;  1OHR_B;  2P3C_A;  2P3C_B;  3KDC_A;  3KDC_B;  1IDB_A;  1IDB_B;  1RL8_A;  1RL8_B;  2AZB_A;  1IZI_A;  1IZI_B;  2AQU_A;  2AQU_B;  1EC1_A;  1EC1_B;  1K6P_A;  1K6P_B;  2BQV_A;  2BQV_B;  7HVP_A;  7HVP_B;  2AZC_A;  2AZC_B;  1TSU_A;  1TSU_B;  4RVI_A;  4RVI_B;  4RVI_C;  4RVI_D;  1HEG_E;  4TVH_A;  4TVH_B;  6OPY_A;  6OPY_B;  3EM3_A;  3EM3_B;  6UPJ_A;  6UPJ_B;  3EKP_A;  3EKP_B;  3EKP_C;  3EKP_D;  2AZ8_A;  1SIP_A;  1Z8C_A;  1Z8C_B;  3T11_A;  3T11_B;  2Q63_A;  2Q63_B;  6OOU_A;  6OOU_B;  8HVP_A;  8HVP_B;  1HTF_A;  1HTF_B;  1GNO_A;  1GNO_B;  1K6C_A;  1K6C_B;  1K6T_A;  1K6T_B;  1GNM_A;  1GNM_B;  4TVG_A;  4TVG_B;  4HVP_A;  4HVP_B;  1HBV_A;  1HBV_B;  3EKQ_A;  3EKQ_B;  1UPJ_A;  1MT8_A;  1MT8_B;  1YTH_A;  1YTH_B;  1YTG_A;  1YTG_B;  6OPS_A;  6OPS_B;  1TCX_A;  1TCX_B;  2NXM_A;  2NXM_B;  1K2C_A;  1K2C_B;  5UPJ_A;  5UPJ_B;  1T7J_A;  1T7J_B;  1GNN_A;  1GNN_B;  1EBY_A;  1EBY_B;  1HXB_A;  1HXB_B;  1A8G_A;  1A8G_B;  1A9M_A;  1A9M_B;  2QAK_A;  2QAK_B;  4M8Y_A;  4M8Y_B;  1HOS_A;  1HOS_B;  3TTP_A;  3TTP_B;  4CPU_A;  4CPU_B;  1SBG_A;  1SBG_B;  1LZQ_A;  1LZQ_B;  2B7Z_A;  2B7Z_B;  4K4P_A;  4K4P_B;  6OPX_A;  6OPX_B;  4GYE_A;  4GYE_B;  1YTI_A;  1U8G_A;  1U8G_B;  1HPS_A;  1HPS_B;  3OQA_A;  1C70_A;  1C70_B;  5KQX_A;  5KQX_B;  1VIJ_A;  1VIJ_B;  1VIK_A;  1VIK_B;  2B60_A;  2B60_B;  1HSI_A;  1HSI_B;  4EJ8_A;  4EJ8_B;  1N49_A;  1N49_B;  1N49_C;  1N49_D;  4FAE_A;  4FAE_B;  4CPX_A;  4CPX_B;  2Z54_A;  2Z54_B;  2QNQ_A;  2QNQ_B;  4COE_A;  4COE_B;  2BPZ_A;  2BPZ_B;  2A4F_A;  2A4F_B;  3UPJ_A;  3UPJ_B;  1ZLF_A;  1ZLF_B;  1M0B_A;  1M0B_B;  2HB4_A;  2SAM_A;  1YTJ_A;  3UHL_A;  3UHL_B;  3UHL_C;  3UHL_D;  2R5P_A;  2R5P_B;  2R5P_C;  2R5P_D;  1D4S_A;  1D4S_B;  1JLD_A;  1JLD_B;  1HPO_A;  1HPO_B;  1C6Y_A;  1C6Y_B;  1C6Z_A;  1C6Z_B;  3AID_A;  3AID_B;  1TCW_A;  1TCW_B;  2Q64_A;  2Q64_B;  6OPZ_A;  6OPZ_B;  4EJL_A;  4EJL_B;  6OPW_A;  6OPW_B;  1SIV_A;  1SIV_B;  1AAQ_A;  1AAQ_B;  1MTB_A;  1MTB_B;  1BDQ_A;  1BDQ_B;  1IVP_A;  1IVP_B;  1C6X_A;  1C6X_B;  3PJ6_A;  1IVQ_A;  1IVQ_B;  1FB7_A;  1HTE_A;  1HTE_B;  4CPQ_A;  4CPQ_B;  2BPW_A;  2BPW_B;  2UPJ_A;  2UPJ_B;  2HPF_A;  2HPF_B;  1SH9_A;  1SH9_B;  2BPX_A;  2BPX_B;  2R5Q_A;  2R5Q_B;  2R5Q_C;  2R5Q_D;  1HHP_A;  9HVP_A;  9HVP_B;  3PHV_A;  3HVP_A;  3GGA_A;  3GGA_B;  3GGA_C;  3GGA_D;  3GGA_G;  3GGA_H;  2P3D_A;  2P3D_B;  2FDE_A;  2FDE_B;  2CEJ_A;  2CEJ_B;  2QHC_A;  2QHC_B;  3GGX_A;  3GGX_B;  3GGX_C;  3GGX_D;  3GGX_E;  3GGX_F;  3GGX_G;  3GGX_H;  4DQG_A;  4DQG_B;  1BDL_A;  1BDL_B;  1BDR_A;  1BDR_B;  3D3T_A;  3D3T_B;  2AZ9_A;  3U71_A;  1KJ4_A;  1KJ4_B;  1KJ4_C;  1KJ4_D;  2HB2_A;  1FQX_A;  1FQX_B;  1RQ9_A;  1RQ9_B;  3SO9_A;  3SO9_B;  3S85_A;  3S85_B;  3S85_C;  3S85_D;  3S85_E;  3S85_F;  3S85_G;  3S85_H;  3S85_I;  3S85_J;  3S85_K;  3S85_L;  3GGV_A;  3GGV_B;  3GGV_C;  3GGV_D;  3GGV_E;  3GGV_F;  3GGV_G;  3GGV_H;  3GGV_I;  1RV7_A;  1RV7_B;  5W5W_A;  5W5W_B;  1YT9_A;  1YT9_B;  1T7K_A;  1T7K_B;  1MUI_A;  1MUI_B;  2ZYE_A;  2ZYE_B;  1Q9P_A;  1BVE_A;  1BVE_B;  1BVG_A;  1BVG_B;  2HVP_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling