3EMYAB

Crystal structure of trichoderma reesei aspartic proteinase complexed with pepstatin a
A: 159-162,207-211,289-294
Link type Probability Chain A piercings Chain B piercings
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
view details
Unlink Unlink 55% -73A +327A
Interpreting sequences
Chain A Sequence
ETGSAPNHPSDSADSEYITSVSIGTPAQVLPLDFDTGSSDLWVFSSETPKSSATGHAIYTPSKSSTSKKVSGASWSISYGDGSSSSGDVYTDKVTIGGFSVNTQGVESATRVSTEFVQDTVISGLVGLAFDSGNQVRPHPQKTWFSNAASSLAEPLFTADLR--HGQNGSYNFGYIDTSVAKGPVAYTPVDNSQGFWEFTASGYSVGGGK---LNRNSIDGIADTGTTLLLLDDNVVDAYYANVQSAQYDNQQEGVVFDCDEDLPSFSFGVGSSTITIPGDLLNLTPLEEGS----STCFGGLQSSSGIGINIFGDVALKAALVVFDLGNERLGWAQK
Chain A Sequence
XVVXAX
sequence length 329,6
structure length 329,6
publication title Statistical coupling analysis of aspartic proteinases based on crystal structures of the Trichoderma reesei enzyme and its complex with pepstatin A.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trichoderma reesei Aspartic protease
missing residues A: 159-162,207-211,289-294
pdb deposition date2008-09-25
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF00026 AspEukaryotic aspartyl protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.70.10 Mainly Beta Beta Barrel Cathepsin D, subunit A; domain 1 Acid Proteases 3emyA02
2.40.70.10 Mainly Beta Beta Barrel Cathepsin D, subunit A; domain 1 Acid Proteases 3emyA01
3HAUAB 3EKXAB 3GGVDGH 1A8KBDE 3FV3EFN 3GGACD 3EL1AB 3FV3BDJ 3GGXCDG 1A94BDE 3GGXCGH 3EM4UV 3FV3AGI 3FV3CHK 3EM4AU 3GGXAB 3GGVABH 3GGXEF 3DOXAQ 3GGXACD 3FV3DL 3GGVABE 1A8KDE 3GGXBCD 3JW2AB 3ECGAB 3FV3BEM 3EKPCD 1A30AC 3GGVAB 3EKTABD 3GGACGH 3GI0AC 3FV3HNP 3FV3ADL 3GI5AB 3GGAABD 3GGXFGH 3IXOAB 1AIDAB 3GGABCD 1A94DE 3EM4AB 3HAWAB 3GGXABG 3EKQAB 3FV3BGJ 3GGVEFH 3GGXABH 3GGVFGH 3FV3CIK 3GGVCDE 3HDKAB 3FV3DEF 3GGXEFH 3GGVGH 3FV3GO 3GGXDEF 3DOXAPQ 3GGXCEF 3GGACDG 3FV3CEF 3GGAAGH 3FV3CK 3FV3DEL 3FV3EFH 3GGXBEF 3GGXCDF 3GGVAGH 3EM4BUV 3GGAAB 3EKTAB 1A94ABD 3FV3CGO 3FV3BJL 3FV3EJM 3EM6AB 3FV3DLO 3FV3FHN 3GGVABD 3GGAACD 3EKPBCD 3FV3CFK 3FV3ABJ 3GGXAEF 3FV3BDL 3GGXCDE 3FV3EHP 3FV3EMN 3GGXEGH 3GGVBCD 3GGVDEF 3JVYAB 3GGVABG 3GI6AB 3FV3GHO 3EC0AB 3FV3ACK 3FV3FIN 3EKPACD 3GGXCDH 3GGVGHI 3GGXABF 3GGXDGH 3GGVEFG 3GGACDH 3FV3DFL 3EL9AB 1AJVAB 3FV3BJ 3EL4AB 3FV3FGN 3EM3AB 3FV3BCJ 3EKYAB 1A8KADE 3DOXAP 3FV3EM 3FV3BHJ 3GGXAGH 3GGXABE 3GGXBGH 3GGXGH 1A8KAB 3FV3CDK 3FV3AGO 3GGUAB 3HBOAB 3FV3AI 1A94AB 3GGAGH 3GGVCEF 3FV3DEM 3GGVCDG 3EMYAB 3FV3BHP 3FV3AEI 3H5BAB 3GGVEF 3JVWAB 3EKVAB 3GI4AB 3GGVEGH 3FV3GHP 3FV3BFJ 3GGVCD 3FV3BJO 3EKTBCD 3FV3CKN 3GGABGH 3GGVAEF 3FV3ADI 3GGVABC 3DK1AB 3EM4ABU 3FX5AB 3EKPABC 3FV3CHP 3EL0AB 3GGAABG 3FV3AEM 3EM4ABV 3EKWAB 3FV3AFI 3GGADGH 3FV3DHL 3GGVABI 1A94ADE 3GGVABF 3FV3CEK 3GGVCDH 3FV3EGO 3GGVCDI 3EKPABD 3FV3EF 3GGAABH 1A30AB 1A8KABE 3FV3DGO 3EKTABC 3GGVACD 3FV3AFN 3FV3FGO 3FV3HP 3FV3BCK 3FV3AHI 3GGVCGH 3FV3ACI 3FV3CFN 3FV3CKP 1AJXAB 3EKPAB 3GGXABD 1A30ABC 3GGVEFI 1AAQAB 3EKTCD 3FV3BGO 3FV3DGL 3FV3DFN 1A30BC 3FV3ABI 3FV3AHP 1A9MAB 3FV3CEM 3GGVCDF 3EM4AUV 3GGVBGH 1A8KABD 3FV3BDG 3GGAABC 3FV3EGM 3FV3EHM 3GGVBEF 1A8GAB 3GGXABC 3EKTACD 3FV3ABG 3GGXEFG 3GGXCD 3EL5AB 1A94ABE 3FV3EFM 3FV3FN
chains in the LinkProt database with same CATH superfamily
3HAUAB 3EKXAB 3GGVDGH 1A8KBDE 3FV3EFN 3GGACD 3EL1AB 3FV3BDJ 3GGXCDG 1A94BDE 3GGXCGH 3EM4UV 3FV3AGI 3FV3CHK 3EM4AU 3GGXAB 3GGVABH 3GGXEF 3DOXAQ 3GGXACD 3FV3DL 3GGVABE 1A8KDE 3GGXBCD 3JW2AB 3ECGAB 3FV3BEM 3EKPCD 1A30AC 3GGVAB 3EKTABD 3GGACGH 3GI0AC 3FV3HNP 3FV3ADL 3GI5AB 3GGAABD 3GGXFGH 3IXOAB 1AIDAB 3GGABCD 1A94DE 3EM4AB 3HAWAB 3GGXABG 3EKQAB 3FV3BGJ 3GGVEFH 3GGXABH 3GGVFGH 3FV3CIK 3GGVCDE 3HDKAB 3FV3DEF 3GGXEFH 3GGVGH 3FV3GO 3GGXDEF 3DOXAPQ 3GGXCEF 3GGACDG 3FV3CEF 3GGAAGH 3FV3CK 3FV3DEL 3FV3EFH 3GGXBEF 3GGXCDF 3GGVAGH 3EM4BUV 3GGAAB 3EKTAB 1A94ABD 3FV3CGO 3FV3BJL 3FV3EJM 3EM6AB 3FV3DLO 3FV3FHN 3GGVABD 3GGAACD 3EKPBCD 3FV3CFK 3FV3ABJ 3GGXAEF 3FV3BDL 3GGXCDE 3FV3EHP 3FV3EMN 3GGXEGH 3GGVBCD 3GGVDEF 3JVYAB 3GGVABG 3GI6AB 3FV3GHO 3EC0AB 3FV3ACK 3FV3FIN 3EKPACD 3GGXCDH 3GGVGHI 3GGXABF 3GGXDGH 3GGVEFG 3GGACDH 3FV3DFL 3EL9AB 1AJVAB 3FV3BJ 3EL4AB 3FV3FGN 3EM3AB 3FV3BCJ 3EKYAB 1A8KADE 3DOXAP 3FV3EM 3FV3BHJ 3GGXAGH 3GGXABE 3GGXBGH 3GGXGH 1A8KAB 3FV3CDK 3FV3AGO 3GGUAB 3HBOAB 3FV3AI 1A94AB 3GGAGH 3GGVCEF 3FV3DEM 3GGVCDG 3EMYAB 3FV3BHP 3FV3AEI 3H5BAB 3GGVEF 3JVWAB 3EKVAB 3GI4AB 3GGVEGH 3FV3GHP 3FV3BFJ 3GGVCD 3FV3BJO 3EKTBCD 3FV3CKN 3GGABGH 3GGVAEF 3FV3ADI 3GGVABC 3DK1AB 3EM4ABU 3FX5AB 3EKPABC 3FV3CHP 3EL0AB 3GGAABG 3FV3AEM 3EM4ABV 3EKWAB 3FV3AFI 3GGADGH 3FV3DHL 3GGVABI 1A94ADE 3GGVABF 3FV3CEK 3GGVCDH 3FV3EGO 3GGVCDI 3EKPABD 3FV3EF 3GGAABH 1A30AB 1A8KABE 3FV3DGO 3EKTABC 3GGVACD 3FV3AFN 3FV3FGO 3FV3HP 3FV3BCK 3FV3AHI 3GGVCGH 3FV3ACI 3FV3CFN 3FV3CKP 1AJXAB 3EKPAB 3GGXABD 1A30ABC 3GGVEFI 1AAQAB 3EKTCD 3FV3BGO 3FV3DGL 3FV3DFN 1A30BC 3FV3ABI 3FV3AHP 1A9MAB 3FV3CEM 3GGVCDF 3EM4AUV 3GGVBGH 1A8KABD 3FV3BDG 3GGAABC 3FV3EGM 3FV3EHM 3GGVBEF 1A8GAB 3GGXABC 3EKTACD 3FV3ABG 3GGXEFG 3GGXCD 3EL5AB 1A94ABE 3FV3EFM 3FV3FN
chains in the LinkProt database with same CATH topology
3HAUAB 3EKXAB 3GGVDGH 1A8KBDE 3FV3EFN 3GGACD 3EL1AB 3FV3BDJ 3GGXCDG 1A94BDE 3GGXCGH 3EM4UV 3FV3AGI 3FV3CHK 3EM4AU 3GGXAB 3GGVABH 3GGXEF 3DOXAQ 3GGXACD 3FV3DL 3GGVABE 1A8KDE 3GGXBCD 3JW2AB 3ECGAB 3FV3BEM 3EKPCD 1A30AC 3GGVAB 3EKTABD 3GGACGH 3GI0AC 3FV3HNP 3FV3ADL 3GI5AB 3GGAABD 3GGXFGH 3IXOAB 1AIDAB 3GGABCD 1A94DE 3EM4AB 3HAWAB 3GGXABG 3EKQAB 3FV3BGJ 3GGVEFH 3GGXABH 3GGVFGH 3FV3CIK 3GGVCDE 3HDKAB 3FV3DEF 3GGXEFH 3GGVGH 3FV3GO 3GGXDEF 3DOXAPQ 3GGXCEF 3GGACDG 3FV3CEF 3GGAAGH 3FV3CK 3FV3DEL 3FV3EFH 3GGXBEF 3GGXCDF 3GGVAGH 3EM4BUV 3GGAAB 3EKTAB 1A94ABD 3FV3CGO 3FV3BJL 3FV3EJM 3EM6AB 3FV3DLO 3FV3FHN 3GGVABD 3GGAACD 3EKPBCD 3FV3CFK 3FV3ABJ 3GGXAEF 3FV3BDL 3GGXCDE 3FV3EHP 3FV3EMN 3GGXEGH 3GGVBCD 3GGVDEF 3JVYAB 3GGVABG 3GI6AB 3FV3GHO 3EC0AB 3FV3ACK 3FV3FIN 3EKPACD 3GGXCDH 3GGVGHI 3GGXABF 3GGXDGH 3GGVEFG 3GGACDH 3FV3DFL 3EL9AB 1AJVAB 3FV3BJ 3EL4AB 3FV3FGN 3EM3AB 3FV3BCJ 3EKYAB 1A8KADE 3DOXAP 3FV3EM 3FV3BHJ 3GGXAGH 3GGXABE 3GGXBGH 3GGXGH 1A8KAB 3FV3CDK 3FV3AGO 3GGUAB 3HBOAB 3FV3AI 1A94AB 3GGAGH 3GGVCEF 3FV3DEM 3GGVCDG 3EMYAB 3FV3BHP 3FV3AEI 3H5BAB 3GGVEF 3JVWAB 3EKVAB 3GI4AB 3GGVEGH 3FV3GHP 3FV3BFJ 3GGVCD 3FV3BJO 3EKTBCD 3FV3CKN 3GGABGH 3GGVAEF 3FV3ADI 3GGVABC 3DK1AB 3EM4ABU 3FX5AB 3EKPABC 3FV3CHP 3EL0AB 3GGAABG 3FV3AEM 3EM4ABV 3EKWAB 3FV3AFI 3GGADGH 3FV3DHL 3GGVABI 1A94ADE 3GGVABF 3FV3CEK 3GGVCDH 3FV3EGO 3GGVCDI 3EKPABD 3FV3EF 3GGAABH 1A30AB 1A8KABE 3FV3DGO 3EKTABC 3GGVACD 3FV3AFN 3FV3FGO 3FV3HP 3FV3BCK 3FV3AHI 3GGVCGH 3FV3ACI 3FV3CFN 3FV3CKP 1AJXAB 3EKPAB 3GGXABD 1A30ABC 3GGVEFI 1AAQAB 3EKTCD 3FV3BGO 3FV3DGL 3FV3DFN 1A30BC 3FV3ABI 3FV3AHP 1A9MAB 3FV3CEM 3GGVCDF 3EM4AUV 3GGVBGH 1A8KABD 3FV3BDG 3GGAABC 3FV3EGM 3FV3EHM 3GGVBEF 1A8GAB 3GGXABC 3EKTACD 3FV3ABG 3GGXEFG 3GGXCD 3EL5AB 1A94ABE 3FV3EFM 3FV3FN
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3HAU AB;  3EKX AB;  3GGV DGH;  1A8K BDE;  3FV3 EFN;  3GGA CD;  3EL1 AB;  3FV3 BDJ;  3GGX CDG;  1A94 BDE;  3GGX CGH;  3EM4 UV;  3FV3 AGI;  3FV3 CHK;  3EM4 AU;  3GGX AB;  3GGV ABH;  3GGX EF;  3DOX AQ;  3GGX ACD;  3FV3 DL;  3GGV ABE;  1A8K DE;  3GGX BCD;  3JW2 AB;  3ECG AB;  3FV3 BEM;  3EKP CD;  1A30 AC;  3GGV AB;  3EKT ABD;  3GGA CGH;  3GI0 AC;  3FV3 HNP;  3FV3 ADL;  3GI5 AB;  3GGA ABD;  3GGX FGH;  3IXO AB;  1AID AB;  3GGA BCD;  1A94 DE;  3EM4 AB;  3HAW AB;  3GGX ABG;  3EKQ AB;  3FV3 BGJ;  3GGV EFH;  3GGX ABH;  3GGV FGH;  3FV3 CIK;  3GGV CDE;  3HDK AB;  3FV3 DEF;  3GGX EFH;  3GGV GH;  3FV3 GO;  3GGX DEF;  3DOX APQ;  3GGX CEF;  3GGA CDG;  3FV3 CEF;  3GGA AGH;  3FV3 CK;  3FV3 DEL;  3FV3 EFH;  3GGX BEF;  3GGX CDF;  3GGV AGH;  3EM4 BUV;  3GGA AB;  3EKT AB;  1A94 ABD;  3FV3 CGO;  3FV3 BJL;  3FV3 EJM;  3EM6 AB;  3FV3 DLO;  3FV3 FHN;  3GGV ABD;  3GGA ACD;  3EKP BCD;  3FV3 CFK;  3FV3 ABJ;  3GGX AEF;  3FV3 BDL;  3GGX CDE;  3FV3 EHP;  3FV3 EMN;  3GGX EGH;  3GGV BCD;  3GGV DEF;  3JVY AB;  3GGV ABG;  3GI6 AB;  3FV3 GHO;  3EC0 AB;  3FV3 ACK;  3FV3 FIN;  3EKP ACD;  3GGX CDH;  3GGV GHI;  3GGX ABF;  3GGX DGH;  3GGV EFG;  3GGA CDH;  3FV3 DFL;  3EL9 AB;  1AJV AB;  3FV3 BJ;  3EL4 AB;  3FV3 FGN;  3EM3 AB;  3FV3 BCJ;  3EKY AB;  1A8K ADE;  3DOX AP;  3FV3 EM;  3FV3 BHJ;  3GGX AGH;  3GGX ABE;  3GGX BGH;  3GGX GH;  1A8K AB;  3FV3 CDK;  3FV3 AGO;  3GGU AB;  3HBO AB;  3FV3 AI;  1A94 AB;  3GGA GH;  3GGV CEF;  3FV3 DEM;  3GGV CDG;  3EMY AB;  3FV3 BHP;  3FV3 AEI;  3H5B AB;  3GGV EF;  3JVW AB;  3EKV AB;  3GI4 AB;  3GGV EGH;  3FV3 GHP;  3FV3 BFJ;  3GGV CD;  3FV3 BJO;  3EKT BCD;  3FV3 CKN;  3GGA BGH;  3GGV AEF;  3FV3 ADI;  3GGV ABC;  3DK1 AB;  3EM4 ABU;  3FX5 AB;  3EKP ABC;  3FV3 CHP;  3EL0 AB;  3GGA ABG;  3FV3 AEM;  3EM4 ABV;  3EKW AB;  3FV3 AFI;  3GGA DGH;  3FV3 DHL;  3GGV ABI;  1A94 ADE;  3GGV ABF;  3FV3 CEK;  3GGV CDH;  3FV3 EGO;  3GGV CDI;  3EKP ABD;  3FV3 EF;  3GGA ABH;  1A30 AB;  1A8K ABE;  3FV3 DGO;  3EKT ABC;  3GGV ACD;  3FV3 AFN;  3FV3 FGO;  3FV3 HP;  3FV3 BCK;  3FV3 AHI;  3GGV CGH;  3FV3 ACI;  3FV3 CFN;  3FV3 CKP;  1AJX AB;  3EKP AB;  3GGX ABD;  1A30 ABC;  3GGV EFI;  1AAQ AB;  3EKT CD;  3FV3 BGO;  3FV3 DGL;  3FV3 DFN;  1A30 BC;  3FV3 ABI;  3FV3 AHP;  1A9M AB;  3FV3 CEM;  3GGV CDF;  3EM4 AUV;  3GGV BGH;  1A8K ABD;  3FV3 BDG;  3GGA ABC;  3FV3 EGM;  3FV3 EHM;  3GGV BEF;  1A8G AB;  3GGX ABC;  3EKT ACD;  3FV3 ABG;  3GGX EFG;  3GGX CD;  3EL5 AB;  1A94 ABE;  3FV3 EFM;  3FV3 FN; 
#chains in the LinkProt database with same CATH topology
 3HAU AB;  3EKX AB;  3GGV DGH;  1A8K BDE;  3FV3 EFN;  3GGA CD;  3EL1 AB;  3FV3 BDJ;  3GGX CDG;  1A94 BDE;  3GGX CGH;  3EM4 UV;  3FV3 AGI;  3FV3 CHK;  3EM4 AU;  3GGX AB;  3GGV ABH;  3GGX EF;  3DOX AQ;  3GGX ACD;  3FV3 DL;  3GGV ABE;  1A8K DE;  3GGX BCD;  3JW2 AB;  3ECG AB;  3FV3 BEM;  3EKP CD;  1A30 AC;  3GGV AB;  3EKT ABD;  3GGA CGH;  3GI0 AC;  3FV3 HNP;  3FV3 ADL;  3GI5 AB;  3GGA ABD;  3GGX FGH;  3IXO AB;  1AID AB;  3GGA BCD;  1A94 DE;  3EM4 AB;  3HAW AB;  3GGX ABG;  3EKQ AB;  3FV3 BGJ;  3GGV EFH;  3GGX ABH;  3GGV FGH;  3FV3 CIK;  3GGV CDE;  3HDK AB;  3FV3 DEF;  3GGX EFH;  3GGV GH;  3FV3 GO;  3GGX DEF;  3DOX APQ;  3GGX CEF;  3GGA CDG;  3FV3 CEF;  3GGA AGH;  3FV3 CK;  3FV3 DEL;  3FV3 EFH;  3GGX BEF;  3GGX CDF;  3GGV AGH;  3EM4 BUV;  3GGA AB;  3EKT AB;  1A94 ABD;  3FV3 CGO;  3FV3 BJL;  3FV3 EJM;  3EM6 AB;  3FV3 DLO;  3FV3 FHN;  3GGV ABD;  3GGA ACD;  3EKP BCD;  3FV3 CFK;  3FV3 ABJ;  3GGX AEF;  3FV3 BDL;  3GGX CDE;  3FV3 EHP;  3FV3 EMN;  3GGX EGH;  3GGV BCD;  3GGV DEF;  3JVY AB;  3GGV ABG;  3GI6 AB;  3FV3 GHO;  3EC0 AB;  3FV3 ACK;  3FV3 FIN;  3EKP ACD;  3GGX CDH;  3GGV GHI;  3GGX ABF;  3GGX DGH;  3GGV EFG;  3GGA CDH;  3FV3 DFL;  3EL9 AB;  1AJV AB;  3FV3 BJ;  3EL4 AB;  3FV3 FGN;  3EM3 AB;  3FV3 BCJ;  3EKY AB;  1A8K ADE;  3DOX AP;  3FV3 EM;  3FV3 BHJ;  3GGX AGH;  3GGX ABE;  3GGX BGH;  3GGX GH;  1A8K AB;  3FV3 CDK;  3FV3 AGO;  3GGU AB;  3HBO AB;  3FV3 AI;  1A94 AB;  3GGA GH;  3GGV CEF;  3FV3 DEM;  3GGV CDG;  3EMY AB;  3FV3 BHP;  3FV3 AEI;  3H5B AB;  3GGV EF;  3JVW AB;  3EKV AB;  3GI4 AB;  3GGV EGH;  3FV3 GHP;  3FV3 BFJ;  3GGV CD;  3FV3 BJO;  3EKT BCD;  3FV3 CKN;  3GGA BGH;  3GGV AEF;  3FV3 ADI;  3GGV ABC;  3DK1 AB;  3EM4 ABU;  3FX5 AB;  3EKP ABC;  3FV3 CHP;  3EL0 AB;  3GGA ABG;  3FV3 AEM;  3EM4 ABV;  3EKW AB;  3FV3 AFI;  3GGA DGH;  3FV3 DHL;  3GGV ABI;  1A94 ADE;  3GGV ABF;  3FV3 CEK;  3GGV CDH;  3FV3 EGO;  3GGV CDI;  3EKP ABD;  3FV3 EF;  3GGA ABH;  1A30 AB;  1A8K ABE;  3FV3 DGO;  3EKT ABC;  3GGV ACD;  3FV3 AFN;  3FV3 FGO;  3FV3 HP;  3FV3 BCK;  3FV3 AHI;  3GGV CGH;  3FV3 ACI;  3FV3 CFN;  3FV3 CKP;  1AJX AB;  3EKP AB;  3GGX ABD;  1A30 ABC;  3GGV EFI;  1AAQ AB;  3EKT CD;  3FV3 BGO;  3FV3 DGL;  3FV3 DFN;  1A30 BC;  3FV3 ABI;  3FV3 AHP;  1A9M AB;  3FV3 CEM;  3GGV CDF;  3EM4 AUV;  3GGV BGH;  1A8K ABD;  3FV3 BDG;  3GGA ABC;  3FV3 EGM;  3FV3 EHM;  3GGV BEF;  1A8G AB;  3GGX ABC;  3EKT ACD;  3FV3 ABG;  3GGX EFG;  3GGX CD;  3EL5 AB;  1A94 ABE;  3FV3 EFM;  3FV3 FN; 
#chains in the LinkProt database with same CATH homology
 3HAU AB;  3EKX AB;  3GGV DGH;  1A8K BDE;  3FV3 EFN;  3GGA CD;  3EL1 AB;  3FV3 BDJ;  3GGX CDG;  1A94 BDE;  3GGX CGH;  3EM4 UV;  3FV3 AGI;  3FV3 CHK;  3EM4 AU;  3GGX AB;  3GGV ABH;  3GGX EF;  3DOX AQ;  3GGX ACD;  3FV3 DL;  3GGV ABE;  1A8K DE;  3GGX BCD;  3JW2 AB;  3ECG AB;  3FV3 BEM;  3EKP CD;  1A30 AC;  3GGV AB;  3EKT ABD;  3GGA CGH;  3GI0 AC;  3FV3 HNP;  3FV3 ADL;  3GI5 AB;  3GGA ABD;  3GGX FGH;  3IXO AB;  1AID AB;  3GGA BCD;  1A94 DE;  3EM4 AB;  3HAW AB;  3GGX ABG;  3EKQ AB;  3FV3 BGJ;  3GGV EFH;  3GGX ABH;  3GGV FGH;  3FV3 CIK;  3GGV CDE;  3HDK AB;  3FV3 DEF;  3GGX EFH;  3GGV GH;  3FV3 GO;  3GGX DEF;  3DOX APQ;  3GGX CEF;  3GGA CDG;  3FV3 CEF;  3GGA AGH;  3FV3 CK;  3FV3 DEL;  3FV3 EFH;  3GGX BEF;  3GGX CDF;  3GGV AGH;  3EM4 BUV;  3GGA AB;  3EKT AB;  1A94 ABD;  3FV3 CGO;  3FV3 BJL;  3FV3 EJM;  3EM6 AB;  3FV3 DLO;  3FV3 FHN;  3GGV ABD;  3GGA ACD;  3EKP BCD;  3FV3 CFK;  3FV3 ABJ;  3GGX AEF;  3FV3 BDL;  3GGX CDE;  3FV3 EHP;  3FV3 EMN;  3GGX EGH;  3GGV BCD;  3GGV DEF;  3JVY AB;  3GGV ABG;  3GI6 AB;  3FV3 GHO;  3EC0 AB;  3FV3 ACK;  3FV3 FIN;  3EKP ACD;  3GGX CDH;  3GGV GHI;  3GGX ABF;  3GGX DGH;  3GGV EFG;  3GGA CDH;  3FV3 DFL;  3EL9 AB;  1AJV AB;  3FV3 BJ;  3EL4 AB;  3FV3 FGN;  3EM3 AB;  3FV3 BCJ;  3EKY AB;  1A8K ADE;  3DOX AP;  3FV3 EM;  3FV3 BHJ;  3GGX AGH;  3GGX ABE;  3GGX BGH;  3GGX GH;  1A8K AB;  3FV3 CDK;  3FV3 AGO;  3GGU AB;  3HBO AB;  3FV3 AI;  1A94 AB;  3GGA GH;  3GGV CEF;  3FV3 DEM;  3GGV CDG;  3EMY AB;  3FV3 BHP;  3FV3 AEI;  3H5B AB;  3GGV EF;  3JVW AB;  3EKV AB;  3GI4 AB;  3GGV EGH;  3FV3 GHP;  3FV3 BFJ;  3GGV CD;  3FV3 BJO;  3EKT BCD;  3FV3 CKN;  3GGA BGH;  3GGV AEF;  3FV3 ADI;  3GGV ABC;  3DK1 AB;  3EM4 ABU;  3FX5 AB;  3EKP ABC;  3FV3 CHP;  3EL0 AB;  3GGA ABG;  3FV3 AEM;  3EM4 ABV;  3EKW AB;  3FV3 AFI;  3GGA DGH;  3FV3 DHL;  3GGV ABI;  1A94 ADE;  3GGV ABF;  3FV3 CEK;  3GGV CDH;  3FV3 EGO;  3GGV CDI;  3EKP ABD;  3FV3 EF;  3GGA ABH;  1A30 AB;  1A8K ABE;  3FV3 DGO;  3EKT ABC;  3GGV ACD;  3FV3 AFN;  3FV3 FGO;  3FV3 HP;  3FV3 BCK;  3FV3 AHI;  3GGV CGH;  3FV3 ACI;  3FV3 CFN;  3FV3 CKP;  1AJX AB;  3EKP AB;  3GGX ABD;  1A30 ABC;  3GGV EFI;  1AAQ AB;  3EKT CD;  3FV3 BGO;  3FV3 DGL;  3FV3 DFN;  1A30 BC;  3FV3 ABI;  3FV3 AHP;  1A9M AB;  3FV3 CEM;  3GGV CDF;  3EM4 AUV;  3GGV BGH;  1A8K ABD;  3FV3 BDG;  3GGA ABC;  3FV3 EGM;  3FV3 EHM;  3GGV BEF;  1A8G AB;  3GGX ABC;  3EKT ACD;  3FV3 ABG;  3GGX EFG;  3GGX CD;  3EL5 AB;  1A94 ABE;  3FV3 EFM;  3FV3 FN; 

1OEWA 1BXOA 1GVUA 1GVTA 5MB5A 4Y5LA 2JJJA 1GVWA 5P73A 4Y4JA 1GVXA 5P70A 5LWSA 5P71A 5P8TA 5P77A 5P76A 5P74A 5MB3A 5P72A 5P6LA 1GVVA 4Y45A 5P5VA 5P4OA 4YCKA 5P5XA 5P64A 5P8RA 5P6UA 5LWTA 5P7FA 5P4MA 5P2SA 4Y38A 5P61A 5P54A 5P6GA 5P5PA 5P3QA 4Y3SA 5P2MA 5P5HA 5P7GA 4Y3ZA 5P7UA 5P4LA 5P2TA 5P65A 5LWUA 4Y4BA 5P7KA 5P6NA 5P50A 5P8SA 5P7QA 4Y5EA 1OEXA 5OZUA 5P53A 4LAPA 5P58A 5P0MA 5P67A 5P2LA 5P51A 4Y3RA 5P32A 5P6FA 5DQ4A 5ISKA 5P19A 5P0TA 5P8QA 5P2OA 5P79A 5P0JA 5P5SA 5P5YA 4YCTA 5P0NA 4Y3LA 4Y3AA 5P4WA 4Y3QA 5P0IA 4ZE6A 5MB0A 5P5JA 5P4RA 5P48A 5P6AA 5P3SA 5HCOA 5P44A 5P59A 4Y58A 5P5IA 5P7LA 5P4GA 5P42A 5P3EA 5P46A 4Y5CA 5P47A 5MB6A 5P7DA 5P5MA 5P3DA 4Y3GA 5P5TA 5P8DA 5P2RA 5P5ZA 5P1QA 5P45A 5P3TA 4Y39A 5P66A 5P6YA 5P3UA 5P6OA 5P3AA 5P5OA 5P7SA 5P7IA 4Y47A 5P3ZA 4YD5A 5P8MA 5P3MA 4Y3HA 5P6IA 5P1XA 5P7HA 5P43A 5P0SA 5P3YA 5P82A 5P4BA 5P5BA 4Y44A 5P39A 4ZEAA 5P8IA 5DR3A 5P8PA 5P40A 4Y5PA 5P6EA 4YD3A 5J25A 5P8EA 5P88A 5LWRA 4Y48A 5DR7A 5P3BA 5P63A 4Y5BA 3PCWA 5P8HA 4Y3EA 5P34A 5P1WA 5OZEA 5P85A 5P8LA 4Y3XA 5P80A 5P7EA 5P35A 4LBTA 5P6QA 5P0FA 5P60A 5P14A 5P1LA 5P4DA 5P7AA 4Y4DA 5OYUA 5P0RA 5P3WA 4Y4AA 5P7ZA 5P6JA 5P4CA 4YD4A 5P3FA 5P8KA 5P3OA 5P1FA 5P31A 5P4ZA 5P3IA 4Y5MA 5P8AA 5P25A 5P89A 5P68A 5P0ZA 5P8FA 5P4NA 5P0XA 5P49A 3PWWA 5P5QA 4Y4EA 5P33A 5P0WA 5P8GA 4Y5NA 5P3CA 5P6RA 5P52A 5P1DA 5P3LA 2WEAA 5P41A 5P5AA 5P6ZA 5P6PA 5P6VA 5P7CA 5P62A 4YD6A 5P7VA 5P2DA 5P84A 5P5KA 5MB7A 5P8CA 5P38A 5P55A 4Y50A 5P0PA 4Y4TA 4Y3JA 5DPZA 3T7XA 5P2VA 5P7JA 4KUPA 5P5WA 5P4SA 5P22A 5P5RA 5P5FA 5P06A 5P1SA 3T6IA 5P1PA 4Y3YA 5P8JA 5P0YA 5P0OA 5P7MA 5P86A 5P4UA 5P1VA 5P5EA 4Y3NA 5OZKA 4LP9A 5P6SA 5P6CA 5P4VA 5P5CA 5P1RA 5P87A 5P1CA 5OZDA 3PRSA 5P6MA 3T7QA 5P18A 1OD1A 5P1IA 3PMYA 5P2QA 5P3JA 5IS4A 4Y3FA 5DR0A 4Y41A 5P7WA 5P1JA 5P2UA 5P3RA 5P4AA 5P1BA 5P11A 4YD7A 3T7PA 4Y3TA 3PLDA 5P4YA 5P28A 5P4EA 5P6XA 5P0VA 5P1AA 5P15A 5P3HA 5P36A 5P26A 5P1TA 5P57A 5P4FA 5P2XA 5P3XA 3Q6YA 4Y4GA 4Y5KA 5P17A 3PSYA 5P5UA 3WZ6A 4Y5AA 5P13A 5P4IA 1BXQA 4L6BA 5P20A 5P7PA 5P75A 4Y35A 5P37A 5P6DA 5OYYA 5DR8A 4Y5GA 4Y3DA 5P3NA 5P8UA 5OYVA 5P2AA 4Y57A 4Y4WA 5P7XA 5P2IA 4Y4ZA 5P3GA 5P27A 5DQ5A 5P4HA 4Y43A 5P1ZA 3PBZA 5OZ0A 5P7TA 5OZ1A 5P6TA 5P0UA 5P3PA 5P4KA 5OYZA 5OZXA 5P8OA 5P3VA 5P29A 5OZGA 5OZBA 5P6BA 5P0QA 5OYRA 5OZ4A 5P2GA 5OZVA 5OZYA 5P69A 5OZHA 5OYQA 3PCZA 5P7BA 5P8NA 5DQ2A 5P6HA 5OYWA 5P7RA 5DR4A 5DQ1A 5OZJA 5P7OA 5DR1A 5OZAA 5P1GA 3PMUA 5OZPA 5P1UA 5P03A 5P0LA 5P02A 5OZMA 5P0GA 5P10A 5P56A 5OZ5A 4Y3PA 5OZQA 5OZIA 5OZZA 2WECA 5P1HA 5P01A 5P2ZA 5P2WA 5P83A 5P00A 5OZFA 5P2NA 5P1OA 5OZNA 5P4JA 2WEBA 5OZWA 5P1NA 5P2EA 2WEDA 4Y3WA 5OZ6A 5P12A 5P1KA 3WZ8A 4Y3MA 5P1YA 5P2JA 5P4XA 5P8BA 5P8VA 5OZ8A 5P4PA 5P1EA 5OJEA 5P4QA 5P81A 5OZOA 5P1MA 5P5DA 2ER7E 5OZ2A 2JJIA 5OZ9A 5P0KA 5P08A 2V00A 5P09A 5P0BA 5P2HA 5OZ7A 5P2YA 5P6WA 4Y56A 4Y54A 5ISJA 5P16A 5P05A 5OYSA 5OYTA 5P5GA 5OYXA 5P7YA 3PI0A 5P6KA 5P7NA 4Y36A 1EPME 1EPNE 4Y51A 5P04A 5P2BA 4Y4XA 5P5NA 3PM4A 5P24A 5P4TA 1PPLE 1PPME 5P07A 5OZCA 5OZSA 3PBDA 5OZLA 5P23A 4Y53A 4LHHA 3APPA 1APUE 1APVE 1APWE 5P2CA 1PPKE 5P5LA 4YCYA 5P78A 1APTE 5OZRA 5P0HA 3PLLA 4Y4UA 5P3KA 2APRA 5P0EA 5OZ3A 5P2FA 5OZTA 3APRE 4Y37A 3C9XA 5P0CA 3ER5E 5P0AA 5P2KA 5ER2E 5P30A 5P0DA 3LZYA 5OG7A 3URJA 1EPPE 3PB5A 3PGIA 4ER1E 1EPQE 1ENTE 3URLA 1IZDA 1EEDP 1UH9A 1IZEA 5APRE 1ER8E 1UH7A 3URIA 1EPOE 4APEA 4ER2E 1EPLE 3ER3E 1E82E 1E5OE 1E80E 2ER6E 5ER1E 1E81E 3WZ7A 2ER9E 4ER4E 1UH8A 1IBQA 1IBQB 1EPRE 6APRE 4APRE 2ER0E 2VS2A 1GKTA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1OEW_A;  1BXO_A;  1GVU_A;  1GVT_A;  5MB5_A;  4Y5L_A;  2JJJ_A;  1GVW_A;  5P73_A;  4Y4J_A;  1GVX_A;  5P70_A;  5LWS_A;  5P71_A;  5P8T_A;  5P77_A;  5P76_A;  5P74_A;  5MB3_A;  5P72_A;  5P6L_A;  1GVV_A;  4Y45_A;  5P5V_A;  5P4O_A;  4YCK_A;  5P5X_A;  5P64_A;  5P8R_A;  5P6U_A;  5LWT_A;  5P7F_A;  5P4M_A;  5P2S_A;  4Y38_A;  5P61_A;  5P54_A;  5P6G_A;  5P5P_A;  5P3Q_A;  4Y3S_A;  5P2M_A;  5P5H_A;  5P7G_A;  4Y3Z_A;  5P7U_A;  5P4L_A;  5P2T_A;  5P65_A;  5LWU_A;  4Y4B_A;  5P7K_A;  5P6N_A;  5P50_A;  5P8S_A;  5P7Q_A;  4Y5E_A;  1OEX_A;  5OZU_A;  5P53_A;  4LAP_A;  5P58_A;  5P0M_A;  5P67_A;  5P2L_A;  5P51_A;  4Y3R_A;  5P32_A;  5P6F_A;  5DQ4_A;  5ISK_A;  5P19_A;  5P0T_A;  5P8Q_A;  5P2O_A;  5P79_A;  5P0J_A;  5P5S_A;  5P5Y_A;  4YCT_A;  5P0N_A;  4Y3L_A;  4Y3A_A;  5P4W_A;  4Y3Q_A;  5P0I_A;  4ZE6_A;  5MB0_A;  5P5J_A;  5P4R_A;  5P48_A;  5P6A_A;  5P3S_A;  5HCO_A;  5P44_A;  5P59_A;  4Y58_A;  5P5I_A;  5P7L_A;  5P4G_A;  5P42_A;  5P3E_A;  5P46_A;  4Y5C_A;  5P47_A;  5MB6_A;  5P7D_A;  5P5M_A;  5P3D_A;  4Y3G_A;  5P5T_A;  5P8D_A;  5P2R_A;  5P5Z_A;  5P1Q_A;  5P45_A;  5P3T_A;  4Y39_A;  5P66_A;  5P6Y_A;  5P3U_A;  5P6O_A;  5P3A_A;  5P5O_A;  5P7S_A;  5P7I_A;  4Y47_A;  5P3Z_A;  4YD5_A;  5P8M_A;  5P3M_A;  4Y3H_A;  5P6I_A;  5P1X_A;  5P7H_A;  5P43_A;  5P0S_A;  5P3Y_A;  5P82_A;  5P4B_A;  5P5B_A;  4Y44_A;  5P39_A;  4ZEA_A;  5P8I_A;  5DR3_A;  5P8P_A;  5P40_A;  4Y5P_A;  5P6E_A;  4YD3_A;  5J25_A;  5P8E_A;  5P88_A;  5LWR_A;  4Y48_A;  5DR7_A;  5P3B_A;  5P63_A;  4Y5B_A;  3PCW_A;  5P8H_A;  4Y3E_A;  5P34_A;  5P1W_A;  5OZE_A;  5P85_A;  5P8L_A;  4Y3X_A;  5P80_A;  5P7E_A;  5P35_A;  4LBT_A;  5P6Q_A;  5P0F_A;  5P60_A;  5P14_A;  5P1L_A;  5P4D_A;  5P7A_A;  4Y4D_A;  5OYU_A;  5P0R_A;  5P3W_A;  4Y4A_A;  5P7Z_A;  5P6J_A;  5P4C_A;  4YD4_A;  5P3F_A;  5P8K_A;  5P3O_A;  5P1F_A;  5P31_A;  5P4Z_A;  5P3I_A;  4Y5M_A;  5P8A_A;  5P25_A;  5P89_A;  5P68_A;  5P0Z_A;  5P8F_A;  5P4N_A;  5P0X_A;  5P49_A;  3PWW_A;  5P5Q_A;  4Y4E_A;  5P33_A;  5P0W_A;  5P8G_A;  4Y5N_A;  5P3C_A;  5P6R_A;  5P52_A;  5P1D_A;  5P3L_A;  2WEA_A;  5P41_A;  5P5A_A;  5P6Z_A;  5P6P_A;  5P6V_A;  5P7C_A;  5P62_A;  4YD6_A;  5P7V_A;  5P2D_A;  5P84_A;  5P5K_A;  5MB7_A;  5P8C_A;  5P38_A;  5P55_A;  4Y50_A;  5P0P_A;  4Y4T_A;  4Y3J_A;  5DPZ_A;  3T7X_A;  5P2V_A;  5P7J_A;  4KUP_A;  5P5W_A;  5P4S_A;  5P22_A;  5P5R_A;  5P5F_A;  5P06_A;  5P1S_A;  3T6I_A;  5P1P_A;  4Y3Y_A;  5P8J_A;  5P0Y_A;  5P0O_A;  5P7M_A;  5P86_A;  5P4U_A;  5P1V_A;  5P5E_A;  4Y3N_A;  5OZK_A;  4LP9_A;  5P6S_A;  5P6C_A;  5P4V_A;  5P5C_A;  5P1R_A;  5P87_A;  5P1C_A;  5OZD_A;  3PRS_A;  5P6M_A;  3T7Q_A;  5P18_A;  1OD1_A;  5P1I_A;  3PMY_A;  5P2Q_A;  5P3J_A;  5IS4_A;  4Y3F_A;  5DR0_A;  4Y41_A;  5P7W_A;  5P1J_A;  5P2U_A;  5P3R_A;  5P4A_A;  5P1B_A;  5P11_A;  4YD7_A;  3T7P_A;  4Y3T_A;  3PLD_A;  5P4Y_A;  5P28_A;  5P4E_A;  5P6X_A;  5P0V_A;  5P1A_A;  5P15_A;  5P3H_A;  5P36_A;  5P26_A;  5P1T_A;  5P57_A;  5P4F_A;  5P2X_A;  5P3X_A;  3Q6Y_A;  4Y4G_A;  4Y5K_A;  5P17_A;  3PSY_A;  5P5U_A;  3WZ6_A;  4Y5A_A;  5P13_A;  5P4I_A;  1BXQ_A;  4L6B_A;  5P20_A;  5P7P_A;  5P75_A;  4Y35_A;  5P37_A;  5P6D_A;  5OYY_A;  5DR8_A;  4Y5G_A;  4Y3D_A;  5P3N_A;  5P8U_A;  5OYV_A;  5P2A_A;  4Y57_A;  4Y4W_A;  5P7X_A;  5P2I_A;  4Y4Z_A;  5P3G_A;  5P27_A;  5DQ5_A;  5P4H_A;  4Y43_A;  5P1Z_A;  3PBZ_A;  5OZ0_A;  5P7T_A;  5OZ1_A;  5P6T_A;  5P0U_A;  5P3P_A;  5P4K_A;  5OYZ_A;  5OZX_A;  5P8O_A;  5P3V_A;  5P29_A;  5OZG_A;  5OZB_A;  5P6B_A;  5P0Q_A;  5OYR_A;  5OZ4_A;  5P2G_A;  5OZV_A;  5OZY_A;  5P69_A;  5OZH_A;  5OYQ_A;  3PCZ_A;  5P7B_A;  5P8N_A;  5DQ2_A;  5P6H_A;  5OYW_A;  5P7R_A;  5DR4_A;  5DQ1_A;  5OZJ_A;  5P7O_A;  5DR1_A;  5OZA_A;  5P1G_A;  3PMU_A;  5OZP_A;  5P1U_A;  5P03_A;  5P0L_A;  5P02_A;  5OZM_A;  5P0G_A;  5P10_A;  5P56_A;  5OZ5_A;  4Y3P_A;  5OZQ_A;  5OZI_A;  5OZZ_A;  2WEC_A;  5P1H_A;  5P01_A;  5P2Z_A;  5P2W_A;  5P83_A;  5P00_A;  5OZF_A;  5P2N_A;  5P1O_A;  5OZN_A;  5P4J_A;  2WEB_A;  5OZW_A;  5P1N_A;  5P2E_A;  2WED_A;  4Y3W_A;  5OZ6_A;  5P12_A;  5P1K_A;  3WZ8_A;  4Y3M_A;  5P1Y_A;  5P2J_A;  5P4X_A;  5P8B_A;  5P8V_A;  5OZ8_A;  5P4P_A;  5P1E_A;  5OJE_A;  5P4Q_A;  5P81_A;  5OZO_A;  5P1M_A;  5P5D_A;  2ER7_E;  5OZ2_A;  2JJI_A;  5OZ9_A;  5P0K_A;  5P08_A;  2V00_A;  5P09_A;  5P0B_A;  5P2H_A;  5OZ7_A;  5P2Y_A;  5P6W_A;  4Y56_A;  4Y54_A;  5ISJ_A;  5P16_A;  5P05_A;  5OYS_A;  5OYT_A;  5P5G_A;  5OYX_A;  5P7Y_A;  3PI0_A;  5P6K_A;  5P7N_A;  4Y36_A;  1EPM_E;  1EPN_E;  4Y51_A;  5P04_A;  5P2B_A;  4Y4X_A;  5P5N_A;  3PM4_A;  5P24_A;  5P4T_A;  1PPL_E;  1PPM_E;  5P07_A;  5OZC_A;  5OZS_A;  3PBD_A;  5OZL_A;  5P23_A;  4Y53_A;  4LHH_A;  3APP_A;  1APU_E;  1APV_E;  1APW_E;  5P2C_A;  1PPK_E;  5P5L_A;  4YCY_A;  5P78_A;  1APT_E;  5OZR_A;  5P0H_A;  3PLL_A;  4Y4U_A;  5P3K_A;  2APR_A;  5P0E_A;  5OZ3_A;  5P2F_A;  5OZT_A;  3APR_E;  4Y37_A;  3C9X_A;  5P0C_A;  3ER5_E;  5P0A_A;  5P2K_A;  5ER2_E;  5P30_A;  5P0D_A;  3LZY_A;  5OG7_A;  3URJ_A;  1EPP_E;  3PB5_A;  3PGI_A;  4ER1_E;  1EPQ_E;  1ENT_E;  3URL_A;  1IZD_A;  1EED_P;  1UH9_A;  1IZE_A;  5APR_E;  1ER8_E;  1UH7_A;  3URI_A;  1EPO_E;  4APE_A;  4ER2_E;  1EPL_E;  3ER3_E;  1E82_E;  1E5O_E;  1E80_E;  2ER6_E;  5ER1_E;  1E81_E;  3WZ7_A;  2ER9_E;  4ER4_E;  1UH8_A;  1IBQ_A;  1IBQ_B;  1EPR_E;  6APR_E;  4APR_E;  2ER0_E;  2VS2_A;  1GKT_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling