3HMGABE

Refinement of the influenza virus hemagglutinin by simulated annealing
Link type Probability Chain A piercings Chain B piercings Chain E piercings
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
view details
Hopf.1 U Ring Hopf.1 U Ring 36% +13B +17E -329A -5E +328E +153B -164B
Interpreting sequences
Chain A Sequence
QDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGQSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQT
Chain A Sequence
GLFGAIAGFIENGWEGMIDGWYGFRHQNSEGTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKG
Chain A Sequence
QDLPGNDNSTATLCLGHHAVPNGTLVKTITDDQIEVTNATELVQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDVPDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYPVLNVTMPNNDNFDKLYIWGIHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPWVRGQSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECITPNGSIPNDKPFQNVNKITYGACPKYVKQNTLKLATGMRNVPEKQT
sequence length 328,175,328
structure length 328,175,328
publication title Refinement of the influenza virus hemagglutinin by simulated annealing.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords HEMAGGLUTININ
source organism Influenza a virus
pdb deposition date1989-09-11
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABE PF00509 HemagglutininHaemagglutinin
ABE PF00509 HemagglutininHaemagglutinin
ABE PF00509 HemagglutininHaemagglutinin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.209.20 Alpha Beta Alpha-Beta Complex Hemagglutinin (Ha1 Chain); Chain: A; domain 1 Hemagglutinin (Ha1 Chain); Chain: A; domain 1 3hmgA01
3.90.20.10 Alpha Beta Alpha-Beta Complex Hemagglutinin Ectodomain; Chain B Hemagglutinin Ectodomain; Chain B 3hmgB00
3.90.209.20 Alpha Beta Alpha-Beta Complex Hemagglutinin (Ha1 Chain); Chain: A; domain 1 Hemagglutinin (Ha1 Chain); Chain: A; domain 1 3hmgE01
3HMGDEF 3HMGBDF 3HMGABF 3HMGCF 3HMGBD 3HMGCEF 3HMGAC 3HMGBC 3HMGADF 3HMGDE 3HMGAE 3HMGABE 3HMGACD 3HMGDF 3HMGCDF 3HMGAB 3HMGBCF 3HMGABD 3HMGADE 3HMGBDE 3HMGCDE 3HMGCD 3HMGBF 3HMGBCE 3HMGEF 3HMGACF 3HMGBEF 3HMGAF 3HMGCE 3HMGBE 3HMGAD 3HMGBCD 3HMGABC 3HMGAEF
chains in the LinkProt database with same CATH superfamily
3HMGDEF 3HMGBDF 3HMGABF 3HMGCF 3HMGBD 3HMGCEF 3HMGAC 3HMGBC 3HMGADF 3HMGDE 3HMGAE 3HMGABE 3HMGACD 3HMGDF 3HMGCDF 3HMGAB 3HMGBCF 3HMGABD 3HMGADE 3HMGBDE 3HMGCDE 3HMGCD 3HMGBF 3HMGBCE 3HMGEF 3HMGACF 3HMGBEF 3HMGAF 3HMGCE 3HMGBE 3HMGAD 3HMGBCD 3HMGABC 3HMGAEF
chains in the LinkProt database with same CATH topology
3HMGDEF 3HMGBDF 3HMGABF 3HMGCF 3HMGBD 3HMGCEF 3HMGAC 3HMGBC 3HMGADF 3HMGDE 3HMGAE 3HMGABE 3HMGACD 3HMGDF 3HMGCDF 3HMGAB 3HMGBCF 3HMGABD 3HMGADE 3HMGBDE 3HMGCDE 3HMGCD 3HMGBF 3HMGBCE 3HMGEF 3HMGACF 3HMGBEF 3HMGAF 3HMGCE 3HMGBE 3HMGAD 3HMGBCD 3HMGABC 3HMGAEF
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3HMG DEF;  3HMG BDF;  3HMG ABF;  3HMG CF;  3HMG BD;  3HMG CEF;  3HMG AC;  3HMG BC;  3HMG ADF;  3HMG DE;  3HMG AE;  3HMG ABE;  3HMG ACD;  3HMG DF;  3HMG CDF;  3HMG AB;  3HMG BCF;  3HMG ABD;  3HMG ADE;  3HMG BDE;  3HMG CDE;  3HMG CD;  3HMG BF;  3HMG BCE;  3HMG EF;  3HMG ACF;  3HMG BEF;  3HMG AF;  3HMG CE;  3HMG BE;  3HMG AD;  3HMG BCD;  3HMG ABC;  3HMG AEF; 
#chains in the LinkProt database with same CATH topology
 3HMG DEF;  3HMG BDF;  3HMG ABF;  3HMG CF;  3HMG BD;  3HMG CEF;  3HMG AC;  3HMG BC;  3HMG ADF;  3HMG DE;  3HMG AE;  3HMG ABE;  3HMG ACD;  3HMG DF;  3HMG CDF;  3HMG AB;  3HMG BCF;  3HMG ABD;  3HMG ADE;  3HMG BDE;  3HMG CDE;  3HMG CD;  3HMG BF;  3HMG BCE;  3HMG EF;  3HMG ACF;  3HMG BEF;  3HMG AF;  3HMG CE;  3HMG BE;  3HMG AD;  3HMG BCD;  3HMG ABC;  3HMG AEF; 
#chains in the LinkProt database with same CATH homology
 3HMG DEF;  3HMG BDF;  3HMG ABF;  3HMG CF;  3HMG BD;  3HMG CEF;  3HMG AC;  3HMG BC;  3HMG ADF;  3HMG DE;  3HMG AE;  3HMG ABE;  3HMG ACD;  3HMG DF;  3HMG CDF;  3HMG AB;  3HMG BCF;  3HMG ABD;  3HMG ADE;  3HMG BDE;  3HMG CDE;  3HMG CD;  3HMG BF;  3HMG BCE;  3HMG EF;  3HMG ACF;  3HMG BEF;  3HMG AF;  3HMG CE;  3HMG BE;  3HMG AD;  3HMG BCD;  3HMG ABC;  3HMG AEF; 

3KU3A 6AORA 6BKRA 6NSBA 4O5NA 6AOUA 6AOVA 6BKSA 3KU5A 4FQIA 6BKTA 3KU6A 6BKOA 4GXXA 4GXXC 4GXXE 6BKNA 5VLIA 4FNKA 4FNKC 4FNKE 5XKUA 4WE6A 4WE6B 6NS9A 1JSDA 4BH4A 5VAGA 4UO0A 4UO0C 4UO0E 6NSAA 6AOTA 4JUMA 3QQBA 4BH3A 3UBQA 3UBQC 3UBQE 3UBQG 3UBQI 3UBQK 6CF5A 6CF5C 6CF5E 6BKPA 4CQYA 4CQYC 4CQYE 6NSFA 1JSMA 4WE5A 5VTZA 5VTZC 5VTZE 5VMCA 5VMCC 5VMCE 5XL4A 5XL4B 3QQEA 5T0BA 5T0BC 5T0BE 4K3XA 4K3XC 4K3XE 4M4YA 4M4YC 4M4YE 6BKMA 6BKMC 6BKME 3UBEA 3UBEC 3UBEE 3UBEG 3UBEI 3UBEK 5XL7A 5XL7B 6BKQA 6BKQC 6BKQE 5TH1A 5TH1C 5TH1E 5T0EA 5T0EC 5T0EE 5VU4A 5VU4C 5VU4E 5VTVA 5VTVC 5VTVE 4BH1A 4BH1C 4BH1E 4BH2A 5XL5A 5XL5B 4BSGA 3GBNA 4CQXA 4CQXC 4CQXE 5W5SA 6NSCA 5XL1A 5XL1B 5VTYA 5VTYC 5VTYE 6E4XB 3UBJA 3UBJC 3UBJE 3UBJG 3UBJI 3UBJK 5XL3A 5XL3B 5T08A 5T08C 5T08E 4CQWA 4CQWC 4CQWE 6AOPA 5BR0A 5BR0C 4XKGA 4XKGC 4XKGE 4LN6A 4LN6C 4LN6E 4LN6G 4LN6I 4LN6K 5THBA 5THBC 5THBE 5VTWA 5VTWC 5VTWE 5VMFA 5VMFC 5VMFE 4WE4A 5TH0A 5TH0C 5TH0E 5TGUA 5TGUC 5TGUE 1RVXA 1RVXC 1RVXE 1RVXG 1RVXI 1RVXK 6NSGA 6AOSA 4QY2A 4QY2C 4QY2E 4QY2G 4QY2I 4QY2K 6CFGA 4JUNA 4JUNC 4JUNE 5TGOA 5TGOC 5TGOE 1RVZA 1RVZC 1RVZE 1RVZG 1RVZI 1RVZK 4CYVA 4CYVC 4CYVE 5XLDA 5XLDB 5T6SA 5T6SC 5T6SE 5T6SG 5T6SI 5T6SK 6CEXA 6CEXC 6CEXE 1JSHA 5K9QA 5K9QC 5K9QE 5K9QM 5K9QO 5K9QQ 5HU8A 5HU8C 5HU8E 5VMGA 5VMGC 5VMGE 1JSIA 4BSHA 5VTRA 5VTRC 5VTRE 5T6NA 5T6NC 5T6NE 5KUYA 5KUYC 5KUYE 4BH0A 4BH0C 4BH0E 4CYZA 4CYZC 4CYZE 5VTUA 5VTUC 5VTUE 4BGXA 6AOQA 5BR6A 5BR6C 5AJMA 4CQRA 4KW1A 4KW1C 4KW1E 4KW1G 3EYKA 5XL6A 5XL6B 5XLCA 5XLCB 4YYAA 3LZGA 3LZGC 3LZGE 3LZGG 3LZGI 3LZGK 1RU7A 1RU7C 1RU7E 1RU7G 1RU7I 1RU7K 4CQUA 4UNWA 4UNWC 4UNWE 5THFA 5THFC 5THFE 4XKFA 4XKFC 4XKFE 1JSOA 4CQSA 4BSBA 5W5UA 4XKDA 4XKDC 4XKDE 4MHIA 4MHIC 4MHIE 4MHIG 4MHII 4MHIK 4MHIM 4MHIO 4MHIQ 4WSTA 4WSTC 4WSTE 4WSTG 4WSTI 4WSTK 4CQQA 4BGWA 4XQ5A 4XQ5C 4XQ5E 4XKEA 4XKEC 4XKEE 3UBNA 3UBNC 3UBNE 3UBNG 3UBNI 3UBNK 4YY9A 6FYUA 6FYUD 6FYUG 4D00A 4D00C 4D00E 5BR3A 5BR3C 2VIUA 4YYBA 3EYJA 4QY0A 4QY0C 4QY0E 4QY0G 4QY0I 4QY0K 5E2YA 5E2YC 5E2YE 1RV0H 1RV0J 1RV0L 4QY1A 4QY1C 4QY1E 4QY1G 4QY1I 4QY1K 4QY1M 4QY1O 4QY1Q 4QY1S 4QY1U 4QY1W 4UO4A 4O58A 4KDMA 4KDMC 4KDME 1RVTH 1RVTJ 1RVTL 4BSAA 4CQPA 4LN8A 4LN8C 4LN8E 4LN8G 4LN8I 4LN8K 5VJKA 5XLBA 5XLBB 5VTXA 5VTXC 5VTXE 4WE7A 4WE7B 4WE7C 4WE7D 4KDOA 4KDOC 4KDOE 3M5JA 3M5JC 3M5JE 4DJ6A 4DJ6C 4DJ6E 3ZNMA 3ZNMC 3ZNME 4KDNA 4KDNC 4KDNE 4BSDA 4N62A 4N62C 3S11A 3S11C 3S11E 1JSNA 5E2ZA 5E2ZC 5E2ZE 4KPQA 4KPQC 4KPQE 4CYWA 4CYWC 4CYWE 2YPGA 2YPGC 2YPGE 5E32A 5BNYA 5BNYC 5BNYE 4UO5A 4UO5C 4UO5E 4UO2A 4UO2C 4UO2E 4BSCA 4BGYA 4KPSA 4KPSC 4KPSE 5E30A 5E30C 5E30E 4N61A 4N61C 5W6RA 5W6RC 5W6RE 5W6RG 3M5GA 3M5GC 3M5GE 4LN3A 4LN3C 4LN3E 4LN3G 4LN3I 4LN3K 5W6TA 4KONA 3ZP2E 4DJ8A 4DJ8C 4DJ8E 3GBMA 3GBMC 5THCA 5THCC 5THCE 5VJLA 4BSIA 4LKKA 4YY0A 4YY0C 4YY0E 3ZNLA 3ZNLC 3ZNLE 4K62A 4K62C 4K62E 4K62G 3ZP6E 1EO8A 5BQYA 5BQYC 5BQYE 4UOAA 4KWMA 4KWMC 4KWME 3EYMA 3EYMC 3EYME 4JUGA 4JUGC 4JUGE 4JUGG 4JUGI 4JUGK 4K64A 4K64C 4K64E 4K64G 1HGEA 1HGEC 1HGEE 4JULA 4JULC 4JULE 4JULH 4JULJ 4JULL 1QFUA 4EDBA 4EDBC 4EDBE 4KOMA 3ZP1E 4BGZA 4BGZC 4BGZE 4BSEA 4WSUA 4WSUC 4WSUE 6FYTA 5E34A 4UO6A 5XRSA 5XRSC 5XRSE 5XRSG 3ZP0E 3ZPAE 3M5HA 3M5HC 3M5HE 4JUHA 4JUHC 4JUHE 4CQVA 4CQVC 4CQVE 4CQZA 4H32A 4H32C 4H32E 4H32G 4H32I 4H32K 4UNYA 4UNYC 4UNYE 4CR0A 1HGJA 1HGJC 1HGJE 4KDQA 4KDQC 4KDQE 4KTHA 4KTHC 4KTHE 4PY8A 3SDYA 6D7UA 6D7UC 6D7UE 1HGIA 1HGIC 1HGIE 4N63A 4N63C 4DJ7A 4DJ7C 4DJ7E 1HGDA 1HGDC 1HGDE 3ZNKA 3ZNKC 3ZNKE 5TGVA 5TGVC 5TGVE 1HGHA 1HGHC 1HGHE 4UNZA 4UNZC 4UNZE 5W08A 5W08B 5W08C 5W08D 5W08E 5W08F 4N5JA 4N5JC 4K67A 4K67C 4K67E 4K67G 4N64A 4N64C 5T0DA 5T0DC 5T0DE 6CF7A 5VJMA 5KANA 5KANC 5KANE 4N5KA 4N5KC 3ZPBE 3ZP3E 5TG9A 5TG9C 5W6GA 4EEFA 4EEFC 4EEFE 5E35A 6ML8A 6E3HA 3HTTA 4BSFA 5VTQA 5VTQC 5VTQE 4YY7A 4YY7C 4K65A 4K65C 4K65E 4K65G 4JUKA 4WSWA 4WSWC 4WSWE 5Y2LA 4EDAA 4EDAC 4GMSA 4GMSC 4GMSE 4LKIA 5VMJA 5VMJC 5VMJE 4UO3A 4UO3C 4UO3E 4JUJA 4JUJC 4JUJE 4HFUA 5HUFA 5HUFC 5HUFE 4LXVA 4LXVC 4LXVE 4LXVG 4LXVI 4LXVK 3M6SA 3M6SC 3M6SE 3M6SG 3M6SI 3M6SK 4WSXA 4WSXC 4WSXE 4WSXG 4WSXI 4WSXK 4WSXM 4WSXO 4WSXQ 4WSXS 4WSXU 4WSXW 3LZFA 3M5IA 3M5IC 3M5IE 4KOLA 4UO8A 3HTOA 1RUYH 1RUYJ 1RUYL 4JTXA 4JTXC 4JTXE 4JTXG 4JTXI 4JTXK 3HTQA 3HTPA 4LN4A 4LN4C 4LN4E 4LN4G 4LN4I 4LN4K 3QQOA 3QQOC 3QQOE 1MQMA 1MQMD 1MQMG 4N60A 4N60C 5BQZA 5BQZC 5BQZE 4LKJA 6N4FA 6N4FC 6N4FE 6N4FG 5XRTA 5XRTC 5XRTE 5XRTG 1HGGA 1HGGC 1HGGE 3ZTNA 3VUNA 3VUNC 3VUNE 4HLZA 4HLZC 4HLZE 5W6UA 6NZ7A 6NZ7E 2IBXA 2IBXC 2IBXE 4K66A 4K66C 4K66E 4K66G 5W6IA 2HMGA 2HMGC 2HMGE 4W8NA 4W8NC 4W8NE 4YY1A 4YY1C 4I78A 4I78B 4JTVA 4JTVC 4JTVE 4JTVG 4JTVI 4JTVK 3HMGC 3HMGE 5GJTA 4LKHA 1TI8A 1HGFA 1HGFC 1HGFE 2WRHH 2WRHJ 2WRHL 4N5ZA 4N5ZC 4N5ZE 4N5ZG 4N5ZI 4N5ZK 4N5ZM 4N5ZO 4N5ZQ 4N5ZS 4N5ZU 4N5ZW 4N5ZY 4N5Za 4N5Zc 3S12A 6D8BA 6D8BC 6D8BE 4HMGA 4HMGC 4HMGE 4N5YA 4N5YC 4N5YE 4N5YG 4N5YI 4N5YK 4N5YM 4N5YO 4N5YQ 4N5YS 4N5YU 4N5YW 4N5YY 4N5Ya 4N5Yc 6N5AA 3AL4A 3AL4C 3AL4E 3AL4G 3AL4I 3AL4K 4JU0A 4JU0C 4JU0E 4JU0G 4JU0I 4JU0K 6D7CA 6D7CC 6D7CE 6D7CG 6D7CI 6D7CK 4HF5A 5A3IA 5A3IE 6E7GA 6E7GC 6E7GE 3S13A 5TG8A 5TG8C 4UO7A 4UO7C 4UO7E 3R2XA 5UGYA 5UGYC 5UGYE 1RUZH 1RUZJ 1RUZL 6II8A 6II8C 6II8E 4LCXA 4LCXC 4LCXE 4R8WA 5HMGA 5HMGC 5HMGE 4UO9A 5GJSA 4XQOA 4XQOC 4XQOE 4XQUA 4XQUC 4XQUE 4LKGA 4LKGC 4LKGE 4ZCJA 4ZCJC 4ZCJE 6II9A 6II9C 6II9E 4GXUA 4GXUC 4GXUE 4GXUG 4GXUI 4GXUK 5W42A 5IBLB 5IBLF 3FKUA 3FKUC 3FKUE 3FKUG 3FKUI 3FKUK 4MHHA 4MHHC 4MHHE 1MQLA 1MQLD 1MQLG 4F3ZA 4F3ZC 4F3ZE 4WSVA 4WSVC 4WSVE 4K63A 4K63C 4K63E 4K63G 6II4A 6II4C 1MQNA 1MQND 1MQNG 4UBDA 4UBDE 4UBDI 4UBDM 4UBDQ 4UBDU 2FK0A 2FK0C 2FK0E 2FK0G 2FK0I 2FK0K 2FK0M 2FK0O 2FK0Q 5XHVA 5XHVE 2WRGH 2WRGJ 2WRGL 1RD8A 1RD8C 1RD8E 6E7HA 6E7HC 6E7HE 4HG4A 4HG4B 4HG4C 4HG4D 4HG4E 4HG4F 4HG4G 4HG4H 4HG4I 6D8DA 6D8DC 6D8DE 3ZTJA 3ZTJC 3ZTJE 4UO1A 4UO1C 4UO1E 5UG0A 4CZ0A 4CZ0C 4CZ0E 5JW3A 5WKOM 5WKON 5WKOO 5WKOS 5WKOT 5WKOU 1KENA 1KENC 1KENE 5Y2MA 5Y2MB 5Y2MC 4NM8A 4NM8C 4NM8E 5JW4A 5JW4C 5JW4E 5JW4G 5JW4I 5JW4K 4UNXA 4UNXC 4UNXE 6B3MA 6B3ME 6B3MG 6B3MK 6B3MQ 6B3MS 5V2AA 4O5IA 4O5IC 4O5IE 4O5IG 4O5II 4O5IK 4FQRA 4FQRC 4FQRE 4FQRG 4FQRI 4FQRK 4FQRM 4FQRO 4FQRQ 4FQRS 4FQRU 4FQRW 4FQVA 4FQVC 4FQVE 4FQYA 4MHJA 4MHJC 4MHJG 4MHJM 4MHJO 4MHJS 6MLMA 6MLMB 6MLMH 6HJNA 6HJNC 6HJNE 6HJPA 6HJPC 6HJPE 6HJQA 6HJQC 6HJQE 6HJRA 6HJRC 6HJRE 5UJZA 5UJZC 5UJZE 5UK0A 5UK0C 5UK0E 5UK1A 5UK1C 5UK1E 5UK2A 5UK2C 5UK2E 3KU3B 6AORB 6BKRB 6NSBB 4O5NB 6AOUB 6AOVB 6BKSB 3KU5B 4FQIB 6BKTB 3KU6B 6BKOB 4GXXB 4GXXD 4GXXF 6BKNB 5VLIB 4FNKB 4FNKD 4FNKF 6NS9B 1JSDB 4BH4B 4UO0B 4UO0D 4UO0F 6NSAB 6AOTB 4JUMB 3QQBB 4BH3B 3UBQB 3UBQD 3UBQF 3UBQH 3UBQJ 3UBQL 6CF5B 6CF5D 6CF5F 6BKPB 4CQYB 4CQYD 4CQYF 6NSFB 1JSMB 4WE5B 5VTZB 5VTZD 5VTZF 5VMCB 5VMCD 5VMCF 5XL4C 5XL4D 3QQEB 5T0BB 5T0BD 5T0BF 4K3XB 4K3XD 4K3XF 4M4YB 4M4YD 4M4YF 6BKMB 6BKMD 6BKMF 3UBEB 3UBED 3UBEF 3UBEH 3UBEJ 3UBEL 5XL7C 5XL7D 6BKQB 6BKQD 6BKQF 5TH1B 5TH1D 5TH1F 5T0EB 5T0ED 5T0EF 5VU4B 5VU4D 5VU4F 5VTVB 5VTVD 5VTVF 4BH1B 4BH1D 4BH1F 4BH2B 5XL5C 5XL5D 4BSGB 3GBNB 4CQXB 4CQXD 4CQXF 5W5SB 6NSCB 5XL1C 5XL1D 5VTYB 5VTYD 5VTYF 3UBJB 3UBJD 3UBJF 3UBJH 3UBJJ 3UBJL 5XL3C 5XL3D 5T08B 5T08D 5T08F 4CQWB 4CQWD 4CQWF 6AOPB 5BR0B 5BR0D 4XKGB 4XKGD 4XKGF 4LN6B 4LN6D 4LN6F 4LN6H 4LN6J 4LN6L 5THBB 5THBD 5THBF 5VTWB 5VTWD 5VTWF 5VMFB 5VMFD 5VMFF 4WE4B 5TH0B 5TH0D 5TH0F 5TGUB 5TGUD 5TGUF 1RVXB 1RVXD 1RVXF 1RVXH 1RVXJ 1RVXL 6NSGB 6AOSB 4QY2B 4QY2D 4QY2F 4QY2H 4QY2J 4QY2L 6CFGB 4JUNB 4JUND 4JUNF 5TGOB 5TGOD 5TGOF 1RVZB 1RVZD 1RVZF 1RVZH 1RVZJ 1RVZL 4CYVB 4CYVD 4CYVF 5XLDC 5XLDD 5T6SB 5T6SD 5T6SF 5T6SH 5T6SJ 5T6SL 6CEXB 6CEXD 6CEXF 1JSHB 5K9QB 5K9QD 5K9QF 5K9QN 5K9QP 5K9QR 5HU8B 5HU8D 5HU8F 5VMGB 5VMGD 5VMGF 1JSIB 4BSHB 5VTRB 5VTRD 5VTRF 5T6NB 5T6ND 5T6NF 5KUYB 5KUYD 5KUYF 4BH0B 4BH0D 4BH0F 4CYZB 4CYZD 4CYZF 5VTUB 5VTUD 5VTUF 4BGXB 6AOQB 5BR6B 5BR6D 5AJMB 4CQRB 4KW1B 4KW1D 4KW1F 4KW1H 3EYKB 5XL6C 5XL6D 5XLCC 5XLCD 4YYAB 3LZGB 3LZGD 3LZGF 3LZGH 3LZGJ 3LZGL 1RU7B 1RU7D 1RU7F 1RU7H 1RU7J 1RU7L 4CQUB 4UNWB 4UNWD 4UNWF 5THFB 5THFD 5THFF 4XKFB 4XKFD 4XKFF 1JSOB 4CQSB 4BSBB 5W5UB 4XKDB 4XKDD 4XKDF 4MHIB 4MHID 4MHIF 4MHIH 4MHIJ 4MHIL 4MHIN 4MHIP 4MHIR 4WSTB 4WSTD 4WSTF 4WSTH 4WSTJ 4WSTL 4CQQB 4BGWB 4XQ5B 4XQ5D 4XQ5F 4XKEB 4XKED 4XKEF 3UBNB 3UBND 3UBNF 3UBNH 3UBNJ 3UBNL 4YY9B 6FYUB 6FYUH 6FYUE 4D00B 4D00D 4D00F 5BR3B 5BR3D 2VIUB 4YYBB 3EYJB 4QY0B 4QY0D 4QY0F 4QY0H 4QY0J 4QY0L 5E2YB 5E2YD 5E2YF 1RV0I 1RV0K 1RV0M 4QY1B 4QY1D 4QY1F 4QY1H 4QY1J 4QY1L 4QY1N 4QY1P 4QY1R 4QY1T 4QY1V 4QY1X 4UO4B 4O58B 4KDMB 4KDMD 4KDMF 1RVTI 1RVTK 1RVTM 4BSAB 4CQPB 4LN8B 4LN8D 4LN8F 4LN8H 4LN8J 4LN8L 5VJKB 5XLBC 5XLBD 5VTXB 5VTXD 5VTXF 4KDOB 4KDOD 4KDOF 3M5JB 3M5JD 3M5JF 4DJ6B 4DJ6D 4DJ6F 3ZNMB 3ZNMD 3ZNMF 4KDNB 4KDND 4KDNF 4BSDB 4N62B 4N62D 3S11B 3S11D 3S11F 1JSNB 5E2ZB 5E2ZD 5E2ZF 4KPQB 4KPQD 4KPQF 4CYWB 4CYWD 4CYWF 2YPGB 2YPGD 2YPGF 5E32B 5BNYB 5BNYD 5BNYF 4UO5B 4UO5D 4UO5F 4UO2B 4UO2D 4UO2F 4BSCB 4BGYB 4KPSB 4KPSD 4KPSF 5E30B 5E30D 5E30F 4N61B 4N61D 5W6RB 5W6RD 5W6RF 5W6RH 3M5GB 3M5GD 3M5GF 4LN3B 4LN3D 4LN3F 4LN3H 4LN3J 4LN3L 5W6TB 4KONB 3ZP2F 4DJ8B 4DJ8D 4DJ8F 3GBMB 3GBMD 5THCB 5THCD 5THCF 5VJLB 4BSIB 4LKKB 4YY0B 4YY0D 4YY0F 3ZNLB 3ZNLD 3ZNLF 4K62B 4K62D 4K62F 4K62H 3ZP6F 1EO8B 5BQYB 5BQYD 5BQYF 4UOAB 4KWMB 4KWMD 4KWMF 3EYMB 3EYMD 3EYMF 4JUGB 4JUGD 4JUGF 4JUGH 4JUGJ 4JUGL 4K64B 4K64D 4K64F 4K64H 1HGEB 1HGED 1HGEF 4JULB 4JULD 4JULF 4JULI 4JULK 4JULM 1QFUB 4EDBB 4EDBD 4EDBF 4KOMB 3ZP1F 4BGZB 4BGZD 4BGZF 4BSEB 4WSUB 4WSUD 4WSUF 6FYTB 5E34B 4UO6B 5XRSB 5XRSD 5XRSF 5XRSH 3ZP0F 3ZPAF 3M5HB 3M5HD 3M5HF 4JUHB 4JUHD 4JUHF 4CQVB 4CQVD 4CQVF 4CQZB 4H32B 4H32D 4H32F 4H32H 4H32J 4H32L 4UNYB 4UNYD 4UNYF 4CR0B 1HGJB 1HGJD 1HGJF 4KDQB 4KDQD 4KDQF 4KTHB 4KTHD 4KTHF 4PY8B 3SDYB 6D7UB 6D7UD 6D7UF 1HGIB 1HGID 1HGIF 4N63B 4N63D 4DJ7B 4DJ7D 4DJ7F 1HGDB 1HGDD 1HGDF 3ZNKB 3ZNKD 3ZNKF 5TGVB 5TGVD 5TGVF 1HGHB 1HGHD 1HGHF 4UNZB 4UNZD 4UNZF 4N5JB 4N5JD 4K67B 4K67D 4K67F 4K67H 4N64B 4N64D 5T0DB 5T0DD 5T0DF 6CF7B 5VJMB 5KANB 5KAND 5KANF 4N5KB 4N5KD 3ZPBF 3ZP3F 5TG9B 5TG9D 5W6GB 4EEFB 4EEFD 4EEFF 5E35B 6ML8B 6E3HB 3HTTB 4BSFB 5VTQB 5VTQD 5VTQF 4YY7B 4YY7D 4K65B 4K65D 4K65F 4K65H 4JUKB 4WSWB 4WSWD 4WSWF 5Y2LB 4EDAB 4EDAD 4GMSB 4GMSD 4GMSF 4LKIB 5VMJB 5VMJD 5VMJF 4UO3B 4UO3D 4UO3F 4JUJB 4JUJD 4JUJF 4HFUB 5HUFB 5HUFD 5HUFF 4LXVB 4LXVD 4LXVF 4LXVH 4LXVJ 4LXVL 3M6SB 3M6SD 3M6SF 3M6SH 3M6SJ 3M6SL 4WSXB 4WSXD 4WSXF 4WSXH 4WSXJ 4WSXL 4WSXN 4WSXP 4WSXR 4WSXT 4WSXV 4WSXX 3LZFB 3M5IB 3M5ID 3M5IF 4KOLB 4UO8B 3HTOB 1RUYI 1RUYK 1RUYM 4JTXB 4JTXD 4JTXF 4JTXH 4JTXJ 4JTXL 3HTQB 3HTPB 4LN4B 4LN4D 4LN4F 4LN4H 4LN4J 4LN4L 3QQOB 3QQOD 3QQOF 4N60B 4N60D 5BQZB 5BQZD 5BQZF 4LKJB 6N4FB 6N4FD 6N4FF 6N4FH 5XRTB 5XRTD 5XRTF 5XRTH 1HGGB 1HGGD 1HGGF 3ZTNB 3VUNB 3VUND 3VUNF 4HLZB 4HLZD 4HLZF 5W6UB 6NZ7B 6NZ7F 2IBXB 2IBXD 2IBXF 4K66B 4K66D 4K66F 4K66H 5W6IB 2HMGB 2HMGD 2HMGF 4W8NB 4W8ND 4W8NF 4YY1B 4YY1D 4I78C 4I78D 4JTVB 4JTVD 4JTVF 4JTVH 4JTVJ 4JTVL 3HMGD 3HMGF 5GJTB 4LKHB 1TI8B 1HGFB 1HGFD 1HGFF 4N5ZB 4N5ZD 4N5ZF 4N5ZH 4N5ZJ 4N5ZL 4N5ZN 4N5ZP 4N5ZR 4N5ZT 4N5ZV 4N5ZX 4N5ZZ 4N5Zb 4N5Zd 3S12B 4HMGB 4HMGD 4HMGF 4N5YB 4N5YD 4N5YF 4N5YH 4N5YJ 4N5YL 4N5YN 4N5YP 4N5YR 4N5YT 4N5YV 4N5YX 4N5YZ 4N5Yb 4N5Yd 6N5AB 3AL4B 3AL4D 3AL4F 3AL4H 3AL4J 3AL4L 4JU0B 4JU0D 4JU0F 4JU0H 4JU0J 4JU0L 4HF5B 5A3IB 5A3IF 6E7GB 6E7GD 6E7GF 3S13B 5TG8B 5TG8D 4UO7B 4UO7D 4UO7F 3R2XB 5UGYB 5UGYD 5UGYF 1RUZI 1RUZK 1RUZM 6II8B 6II8D 6II8F 4LCXB 4LCXD 4LCXF 4R8WB 5HMGB 5HMGD 5HMGF 4UO9B 5GJSB 4XQOB 4XQOD 4XQOF 4XQUB 4XQUD 4XQUF 4LKGB 4LKGD 4LKGF 4ZCJB 4ZCJD 4ZCJF 6II9B 6II9D 6II9F 4GXUB 4GXUD 4GXUF 4GXUH 4GXUJ 4GXUL 5W42B 5IBLA 5IBLE 3FKUB 3FKUD 3FKUF 3FKUH 3FKUJ 3FKUL 4MHHB 4MHHD 4MHHF 4F3ZB 4F3ZD 4F3ZF 4WSVB 4WSVD 4WSVF 4K63B 4K63D 4K63F 4K63H 6II4B 6II4D 4UBDB 4UBDF 4UBDJ 4UBDN 4UBDR 4UBDV 2FK0B 2FK0D 2FK0F 2FK0H 2FK0J 2FK0L 2FK0N 2FK0P 2FK0R 1RD8B 1RD8D 1RD8F 6E7HB 6E7HD 6E7HF 4HG4a 4HG4b 4HG4c 4HG4d 4HG4e 4HG4f 4HG4g 4HG4h 4HG4i 3ZTJB 3ZTJD 3ZTJF 4UO1B 4UO1D 4UO1F 5UG0B 4CZ0B 4CZ0D 4CZ0F 5JW3B 5WKOP 5WKOQ 5WKOR 5WKOV 5WKOW 5WKOX 1KENB 1KEND 1KENF 5Y2MD 5Y2ME 5Y2MF 4NM8B 4NM8D 4NM8F 5JW4B 5JW4D 5JW4F 5JW4H 5JW4J 5JW4L 4UNXB 4UNXD 4UNXF 5CJSD 5CJSK 6B3MB 6B3MF 6B3MH 6B3ML 6B3MR 6B3MT 5V2AB 4O5IB 4O5ID 4O5IF 4O5IH 4O5IJ 4O5IL 4FQRB 4FQRD 4FQRF 4FQRH 4FQRJ 4FQRL 4FQRN 4FQRP 4FQRR 4FQRT 4FQRV 4FQRX 5CJQB 4FQVB 4FQVD 4FQVF 4FQYB 4MHJB 4MHJD 4MHJI 4MHJN 4MHJP 4MHJU 6HJNB 6HJND 6HJNF 6HJPB 6HJPD 6HJPF 5UJZB 5UJZD 5UJZF 5UK0B 5UK0D 5UK0F 5UK1B 5UK1D 5UK1F 5UK2B 5UK2D 5UK2F 3KU3A 6AORA 6BKRA 6NSBA 4O5NA 6AOUA 6AOVA 6BKSA 3KU5A 4FQIA 6BKTA 3KU6A 6BKOA 4GXXA 4GXXC 4GXXE 6BKNA 5VLIA 4FNKA 4FNKC 4FNKE 5XKUA 4WE6A 4WE6B 6NS9A 1JSDA 4BH4A 5VAGA 4UO0A 4UO0C 4UO0E 6NSAA 6AOTA 4JUMA 3QQBA 4BH3A 3UBQA 3UBQC 3UBQE 3UBQG 3UBQI 3UBQK 6CF5A 6CF5C 6CF5E 6BKPA 4CQYA 4CQYC 4CQYE 6NSFA 1JSMA 4WE5A 5VTZA 5VTZC 5VTZE 5VMCA 5VMCC 5VMCE 5XL4A 5XL4B 3QQEA 5T0BA 5T0BC 5T0BE 4K3XA 4K3XC 4K3XE 4M4YA 4M4YC 4M4YE 6BKMA 6BKMC 6BKME 3UBEA 3UBEC 3UBEE 3UBEG 3UBEI 3UBEK 5XL7A 5XL7B 6BKQA 6BKQC 6BKQE 5TH1A 5TH1C 5TH1E 5T0EA 5T0EC 5T0EE 5VU4A 5VU4C 5VU4E 5VTVA 5VTVC 5VTVE 4BH1A 4BH1C 4BH1E 4BH2A 5XL5A 5XL5B 4BSGA 3GBNA 4CQXA 4CQXC 4CQXE 5W5SA 6NSCA 5XL1A 5XL1B 5VTYA 5VTYC 5VTYE 6E4XB 3UBJA 3UBJC 3UBJE 3UBJG 3UBJI 3UBJK 5XL3A 5XL3B 5T08A 5T08C 5T08E 4CQWA 4CQWC 4CQWE 6AOPA 5BR0A 5BR0C 4XKGA 4XKGC 4XKGE 4LN6A 4LN6C 4LN6E 4LN6G 4LN6I 4LN6K 5THBA 5THBC 5THBE 5VTWA 5VTWC 5VTWE 5VMFA 5VMFC 5VMFE 4WE4A 5TH0A 5TH0C 5TH0E 5TGUA 5TGUC 5TGUE 1RVXA 1RVXC 1RVXE 1RVXG 1RVXI 1RVXK 6NSGA 6AOSA 4QY2A 4QY2C 4QY2E 4QY2G 4QY2I 4QY2K 6CFGA 4JUNA 4JUNC 4JUNE 5TGOA 5TGOC 5TGOE 1RVZA 1RVZC 1RVZE 1RVZG 1RVZI 1RVZK 4CYVA 4CYVC 4CYVE 5XLDA 5XLDB 5T6SA 5T6SC 5T6SE 5T6SG 5T6SI 5T6SK 6CEXA 6CEXC 6CEXE 1JSHA 5K9QA 5K9QC 5K9QE 5K9QM 5K9QO 5K9QQ 5HU8A 5HU8C 5HU8E 5VMGA 5VMGC 5VMGE 1JSIA 4BSHA 5VTRA 5VTRC 5VTRE 5T6NA 5T6NC 5T6NE 5KUYA 5KUYC 5KUYE 4BH0A 4BH0C 4BH0E 4CYZA 4CYZC 4CYZE 5VTUA 5VTUC 5VTUE 4BGXA 6AOQA 5BR6A 5BR6C 5AJMA 4CQRA 4KW1A 4KW1C 4KW1E 4KW1G 3EYKA 5XL6A 5XL6B 5XLCA 5XLCB 4YYAA 3LZGA 3LZGC 3LZGE 3LZGG 3LZGI 3LZGK 1RU7A 1RU7C 1RU7E 1RU7G 1RU7I 1RU7K 4CQUA 4UNWA 4UNWC 4UNWE 5THFA 5THFC 5THFE 4XKFA 4XKFC 4XKFE 1JSOA 4CQSA 4BSBA 5W5UA 4XKDA 4XKDC 4XKDE 4MHIA 4MHIC 4MHIE 4MHIG 4MHII 4MHIK 4MHIM 4MHIO 4MHIQ 4WSTA 4WSTC 4WSTE 4WSTG 4WSTI 4WSTK 4CQQA 4BGWA 4XQ5A 4XQ5C 4XQ5E 4XKEA 4XKEC 4XKEE 3UBNA 3UBNC 3UBNE 3UBNG 3UBNI 3UBNK 4YY9A 6FYUA 6FYUD 6FYUG 4D00A 4D00C 4D00E 5BR3A 5BR3C 2VIUA 4YYBA 3EYJA 4QY0A 4QY0C 4QY0E 4QY0G 4QY0I 4QY0K 5E2YA 5E2YC 5E2YE 1RV0H 1RV0J 1RV0L 4QY1A 4QY1C 4QY1E 4QY1G 4QY1I 4QY1K 4QY1M 4QY1O 4QY1Q 4QY1S 4QY1U 4QY1W 4UO4A 4O58A 4KDMA 4KDMC 4KDME 1RVTH 1RVTJ 1RVTL 4BSAA 4CQPA 4LN8A 4LN8C 4LN8E 4LN8G 4LN8I 4LN8K 5VJKA 5XLBA 5XLBB 5VTXA 5VTXC 5VTXE 4WE7A 4WE7B 4WE7C 4WE7D 4KDOA 4KDOC 4KDOE 3M5JA 3M5JC 3M5JE 4DJ6A 4DJ6C 4DJ6E 3ZNMA 3ZNMC 3ZNME 4KDNA 4KDNC 4KDNE 4BSDA 4N62A 4N62C 3S11A 3S11C 3S11E 1JSNA 5E2ZA 5E2ZC 5E2ZE 4KPQA 4KPQC 4KPQE 4CYWA 4CYWC 4CYWE 2YPGA 2YPGC 2YPGE 5E32A 5BNYA 5BNYC 5BNYE 4UO5A 4UO5C 4UO5E 4UO2A 4UO2C 4UO2E 4BSCA 4BGYA 4KPSA 4KPSC 4KPSE 5E30A 5E30C 5E30E 4N61A 4N61C 5W6RA 5W6RC 5W6RE 5W6RG 3M5GA 3M5GC 3M5GE 4LN3A 4LN3C 4LN3E 4LN3G 4LN3I 4LN3K 5W6TA 4KONA 3ZP2E 4DJ8A 4DJ8C 4DJ8E 3GBMA 3GBMC 5THCA 5THCC 5THCE 5VJLA 4BSIA 4LKKA 4YY0A 4YY0C 4YY0E 3ZNLA 3ZNLC 3ZNLE 4K62A 4K62C 4K62E 4K62G 3ZP6E 1EO8A 5BQYA 5BQYC 5BQYE 4UOAA 4KWMA 4KWMC 4KWME 3EYMA 3EYMC 3EYME 4JUGA 4JUGC 4JUGE 4JUGG 4JUGI 4JUGK 4K64A 4K64C 4K64E 4K64G 1HGEA 1HGEC 1HGEE 4JULA 4JULC 4JULE 4JULH 4JULJ 4JULL 1QFUA 4EDBA 4EDBC 4EDBE 4KOMA 3ZP1E 4BGZA 4BGZC 4BGZE 4BSEA 4WSUA 4WSUC 4WSUE 6FYTA 5E34A 4UO6A 5XRSA 5XRSC 5XRSE 5XRSG 3ZP0E 3ZPAE 3M5HA 3M5HC 3M5HE 4JUHA 4JUHC 4JUHE 4CQVA 4CQVC 4CQVE 4CQZA 4H32A 4H32C 4H32E 4H32G 4H32I 4H32K 4UNYA 4UNYC 4UNYE 4CR0A 1HGJA 1HGJC 1HGJE 4KDQA 4KDQC 4KDQE 4KTHA 4KTHC 4KTHE 4PY8A 3SDYA 6D7UA 6D7UC 6D7UE 1HGIA 1HGIC 1HGIE 4N63A 4N63C 4DJ7A 4DJ7C 4DJ7E 1HGDA 1HGDC 1HGDE 3ZNKA 3ZNKC 3ZNKE 5TGVA 5TGVC 5TGVE 1HGHA 1HGHC 1HGHE 4UNZA 4UNZC 4UNZE 5W08A 5W08B 5W08C 5W08D 5W08E 5W08F 4N5JA 4N5JC 4K67A 4K67C 4K67E 4K67G 4N64A 4N64C 5T0DA 5T0DC 5T0DE 6CF7A 5VJMA 5KANA 5KANC 5KANE 4N5KA 4N5KC 3ZPBE 3ZP3E 5TG9A 5TG9C 5W6GA 4EEFA 4EEFC 4EEFE 5E35A 6ML8A 6E3HA 3HTTA 4BSFA 5VTQA 5VTQC 5VTQE 4YY7A 4YY7C 4K65A 4K65C 4K65E 4K65G 4JUKA 4WSWA 4WSWC 4WSWE 5Y2LA 4EDAA 4EDAC 4GMSA 4GMSC 4GMSE 4LKIA 5VMJA 5VMJC 5VMJE 4UO3A 4UO3C 4UO3E 4JUJA 4JUJC 4JUJE 4HFUA 5HUFA 5HUFC 5HUFE 4LXVA 4LXVC 4LXVE 4LXVG 4LXVI 4LXVK 3M6SA 3M6SC 3M6SE 3M6SG 3M6SI 3M6SK 4WSXA 4WSXC 4WSXE 4WSXG 4WSXI 4WSXK 4WSXM 4WSXO 4WSXQ 4WSXS 4WSXU 4WSXW 3LZFA 3M5IA 3M5IC 3M5IE 4KOLA 4UO8A 3HTOA 1RUYH 1RUYJ 1RUYL 4JTXA 4JTXC 4JTXE 4JTXG 4JTXI 4JTXK 3HTQA 3HTPA 4LN4A 4LN4C 4LN4E 4LN4G 4LN4I 4LN4K 3QQOA 3QQOC 3QQOE 1MQMA 1MQMD 1MQMG 4N60A 4N60C 5BQZA 5BQZC 5BQZE 4LKJA 6N4FA 6N4FC 6N4FE 6N4FG 5XRTA 5XRTC 5XRTE 5XRTG 1HGGA 1HGGC 1HGGE 3ZTNA 3VUNA 3VUNC 3VUNE 4HLZA 4HLZC 4HLZE 5W6UA 6NZ7A 6NZ7E 2IBXA 2IBXC 2IBXE 4K66A 4K66C 4K66E 4K66G 5W6IA 2HMGA 2HMGC 2HMGE 4W8NA 4W8NC 4W8NE 4YY1A 4YY1C 4I78A 4I78B 4JTVA 4JTVC 4JTVE 4JTVG 4JTVI 4JTVK 3HMGA 3HMGC 5GJTA 4LKHA 1TI8A 1HGFA 1HGFC 1HGFE 2WRHH 2WRHJ 2WRHL 4N5ZA 4N5ZC 4N5ZE 4N5ZG 4N5ZI 4N5ZK 4N5ZM 4N5ZO 4N5ZQ 4N5ZS 4N5ZU 4N5ZW 4N5ZY 4N5Za 4N5Zc 3S12A 6D8BA 6D8BC 6D8BE 4HMGA 4HMGC 4HMGE 4N5YA 4N5YC 4N5YE 4N5YG 4N5YI 4N5YK 4N5YM 4N5YO 4N5YQ 4N5YS 4N5YU 4N5YW 4N5YY 4N5Ya 4N5Yc 6N5AA 3AL4A 3AL4C 3AL4E 3AL4G 3AL4I 3AL4K 4JU0A 4JU0C 4JU0E 4JU0G 4JU0I 4JU0K 6D7CA 6D7CC 6D7CE 6D7CG 6D7CI 6D7CK 4HF5A 5A3IA 5A3IE 6E7GA 6E7GC 6E7GE 3S13A 5TG8A 5TG8C 4UO7A 4UO7C 4UO7E 3R2XA 5UGYA 5UGYC 5UGYE 1RUZH 1RUZJ 1RUZL 6II8A 6II8C 6II8E 4LCXA 4LCXC 4LCXE 4R8WA 5HMGA 5HMGC 5HMGE 4UO9A 5GJSA 4XQOA 4XQOC 4XQOE 4XQUA 4XQUC 4XQUE 4LKGA 4LKGC 4LKGE 4ZCJA 4ZCJC 4ZCJE 6II9A 6II9C 6II9E 4GXUA 4GXUC 4GXUE 4GXUG 4GXUI 4GXUK 5W42A 5IBLB 5IBLF 3FKUA 3FKUC 3FKUE 3FKUG 3FKUI 3FKUK 4MHHA 4MHHC 4MHHE 1MQLA 1MQLD 1MQLG 4F3ZA 4F3ZC 4F3ZE 4WSVA 4WSVC 4WSVE 4K63A 4K63C 4K63E 4K63G 6II4A 6II4C 1MQNA 1MQND 1MQNG 4UBDA 4UBDE 4UBDI 4UBDM 4UBDQ 4UBDU 2FK0A 2FK0C 2FK0E 2FK0G 2FK0I 2FK0K 2FK0M 2FK0O 2FK0Q 5XHVA 5XHVE 2WRGH 2WRGJ 2WRGL 1RD8A 1RD8C 1RD8E 6E7HA 6E7HC 6E7HE 4HG4A 4HG4B 4HG4C 4HG4D 4HG4E 4HG4F 4HG4G 4HG4H 4HG4I 6D8DA 6D8DC 6D8DE 3ZTJA 3ZTJC 3ZTJE 4UO1A 4UO1C 4UO1E 5UG0A 4CZ0A 4CZ0C 4CZ0E 5JW3A 5WKOM 5WKON 5WKOO 5WKOS 5WKOT 5WKOU 1KENA 1KENC 1KENE 5Y2MA 5Y2MB 5Y2MC 4NM8A 4NM8C 4NM8E 5JW4A 5JW4C 5JW4E 5JW4G 5JW4I 5JW4K 4UNXA 4UNXC 4UNXE 6B3MA 6B3ME 6B3MG 6B3MK 6B3MQ 6B3MS 5V2AA 4O5IA 4O5IC 4O5IE 4O5IG 4O5II 4O5IK 4FQRA 4FQRC 4FQRE 4FQRG 4FQRI 4FQRK 4FQRM 4FQRO 4FQRQ 4FQRS 4FQRU 4FQRW 4FQVA 4FQVC 4FQVE 4FQYA 4MHJA 4MHJC 4MHJG 4MHJM 4MHJO 4MHJS 6MLMA 6MLMB 6MLMH 6HJNA 6HJNC 6HJNE 6HJPA 6HJPC 6HJPE 6HJQA 6HJQC 6HJQE 6HJRA 6HJRC 6HJRE 5UJZA 5UJZC 5UJZE 5UK0A 5UK0C 5UK0E 5UK1A 5UK1C 5UK1E 5UK2A 5UK2C 5UK2E
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3KU3_A;  6AOR_A;  6BKR_A;  6NSB_A;  4O5N_A;  6AOU_A;  6AOV_A;  6BKS_A;  3KU5_A;  4FQI_A;  6BKT_A;  3KU6_A;  6BKO_A;  4GXX_A;  4GXX_C;  4GXX_E;  6BKN_A;  5VLI_A;  4FNK_A;  4FNK_C;  4FNK_E;  5XKU_A;  4WE6_A;  4WE6_B;  6NS9_A;  1JSD_A;  4BH4_A;  5VAG_A;  4UO0_A;  4UO0_C;  4UO0_E;  6NSA_A;  6AOT_A;  4JUM_A;  3QQB_A;  4BH3_A;  3UBQ_A;  3UBQ_C;  3UBQ_E;  3UBQ_G;  3UBQ_I;  3UBQ_K;  6CF5_A;  6CF5_C;  6CF5_E;  6BKP_A;  4CQY_A;  4CQY_C;  4CQY_E;  6NSF_A;  1JSM_A;  4WE5_A;  5VTZ_A;  5VTZ_C;  5VTZ_E;  5VMC_A;  5VMC_C;  5VMC_E;  5XL4_A;  5XL4_B;  3QQE_A;  5T0B_A;  5T0B_C;  5T0B_E;  4K3X_A;  4K3X_C;  4K3X_E;  4M4Y_A;  4M4Y_C;  4M4Y_E;  6BKM_A;  6BKM_C;  6BKM_E;  3UBE_A;  3UBE_C;  3UBE_E;  3UBE_G;  3UBE_I;  3UBE_K;  5XL7_A;  5XL7_B;  6BKQ_A;  6BKQ_C;  6BKQ_E;  5TH1_A;  5TH1_C;  5TH1_E;  5T0E_A;  5T0E_C;  5T0E_E;  5VU4_A;  5VU4_C;  5VU4_E;  5VTV_A;  5VTV_C;  5VTV_E;  4BH1_A;  4BH1_C;  4BH1_E;  4BH2_A;  5XL5_A;  5XL5_B;  4BSG_A;  3GBN_A;  4CQX_A;  4CQX_C;  4CQX_E;  5W5S_A;  6NSC_A;  5XL1_A;  5XL1_B;  5VTY_A;  5VTY_C;  5VTY_E;  6E4X_B;  3UBJ_A;  3UBJ_C;  3UBJ_E;  3UBJ_G;  3UBJ_I;  3UBJ_K;  5XL3_A;  5XL3_B;  5T08_A;  5T08_C;  5T08_E;  4CQW_A;  4CQW_C;  4CQW_E;  6AOP_A;  5BR0_A;  5BR0_C;  4XKG_A;  4XKG_C;  4XKG_E;  4LN6_A;  4LN6_C;  4LN6_E;  4LN6_G;  4LN6_I;  4LN6_K;  5THB_A;  5THB_C;  5THB_E;  5VTW_A;  5VTW_C;  5VTW_E;  5VMF_A;  5VMF_C;  5VMF_E;  4WE4_A;  5TH0_A;  5TH0_C;  5TH0_E;  5TGU_A;  5TGU_C;  5TGU_E;  1RVX_A;  1RVX_C;  1RVX_E;  1RVX_G;  1RVX_I;  1RVX_K;  6NSG_A;  6AOS_A;  4QY2_A;  4QY2_C;  4QY2_E;  4QY2_G;  4QY2_I;  4QY2_K;  6CFG_A;  4JUN_A;  4JUN_C;  4JUN_E;  5TGO_A;  5TGO_C;  5TGO_E;  1RVZ_A;  1RVZ_C;  1RVZ_E;  1RVZ_G;  1RVZ_I;  1RVZ_K;  4CYV_A;  4CYV_C;  4CYV_E;  5XLD_A;  5XLD_B;  5T6S_A;  5T6S_C;  5T6S_E;  5T6S_G;  5T6S_I;  5T6S_K;  6CEX_A;  6CEX_C;  6CEX_E;  1JSH_A;  5K9Q_A;  5K9Q_C;  5K9Q_E;  5K9Q_M;  5K9Q_O;  5K9Q_Q;  5HU8_A;  5HU8_C;  5HU8_E;  5VMG_A;  5VMG_C;  5VMG_E;  1JSI_A;  4BSH_A;  5VTR_A;  5VTR_C;  5VTR_E;  5T6N_A;  5T6N_C;  5T6N_E;  5KUY_A;  5KUY_C;  5KUY_E;  4BH0_A;  4BH0_C;  4BH0_E;  4CYZ_A;  4CYZ_C;  4CYZ_E;  5VTU_A;  5VTU_C;  5VTU_E;  4BGX_A;  6AOQ_A;  5BR6_A;  5BR6_C;  5AJM_A;  4CQR_A;  4KW1_A;  4KW1_C;  4KW1_E;  4KW1_G;  3EYK_A;  5XL6_A;  5XL6_B;  5XLC_A;  5XLC_B;  4YYA_A;  3LZG_A;  3LZG_C;  3LZG_E;  3LZG_G;  3LZG_I;  3LZG_K;  1RU7_A;  1RU7_C;  1RU7_E;  1RU7_G;  1RU7_I;  1RU7_K;  4CQU_A;  4UNW_A;  4UNW_C;  4UNW_E;  5THF_A;  5THF_C;  5THF_E;  4XKF_A;  4XKF_C;  4XKF_E;  1JSO_A;  4CQS_A;  4BSB_A;  5W5U_A;  4XKD_A;  4XKD_C;  4XKD_E;  4MHI_A;  4MHI_C;  4MHI_E;  4MHI_G;  4MHI_I;  4MHI_K;  4MHI_M;  4MHI_O;  4MHI_Q;  4WST_A;  4WST_C;  4WST_E;  4WST_G;  4WST_I;  4WST_K;  4CQQ_A;  4BGW_A;  4XQ5_A;  4XQ5_C;  4XQ5_E;  4XKE_A;  4XKE_C;  4XKE_E;  3UBN_A;  3UBN_C;  3UBN_E;  3UBN_G;  3UBN_I;  3UBN_K;  4YY9_A;  6FYU_A;  6FYU_D;  6FYU_G;  4D00_A;  4D00_C;  4D00_E;  5BR3_A;  5BR3_C;  2VIU_A;  4YYB_A;  3EYJ_A;  4QY0_A;  4QY0_C;  4QY0_E;  4QY0_G;  4QY0_I;  4QY0_K;  5E2Y_A;  5E2Y_C;  5E2Y_E;  1RV0_H;  1RV0_J;  1RV0_L;  4QY1_A;  4QY1_C;  4QY1_E;  4QY1_G;  4QY1_I;  4QY1_K;  4QY1_M;  4QY1_O;  4QY1_Q;  4QY1_S;  4QY1_U;  4QY1_W;  4UO4_A;  4O58_A;  4KDM_A;  4KDM_C;  4KDM_E;  1RVT_H;  1RVT_J;  1RVT_L;  4BSA_A;  4CQP_A;  4LN8_A;  4LN8_C;  4LN8_E;  4LN8_G;  4LN8_I;  4LN8_K;  5VJK_A;  5XLB_A;  5XLB_B;  5VTX_A;  5VTX_C;  5VTX_E;  4WE7_A;  4WE7_B;  4WE7_C;  4WE7_D;  4KDO_A;  4KDO_C;  4KDO_E;  3M5J_A;  3M5J_C;  3M5J_E;  4DJ6_A;  4DJ6_C;  4DJ6_E;  3ZNM_A;  3ZNM_C;  3ZNM_E;  4KDN_A;  4KDN_C;  4KDN_E;  4BSD_A;  4N62_A;  4N62_C;  3S11_A;  3S11_C;  3S11_E;  1JSN_A;  5E2Z_A;  5E2Z_C;  5E2Z_E;  4KPQ_A;  4KPQ_C;  4KPQ_E;  4CYW_A;  4CYW_C;  4CYW_E;  2YPG_A;  2YPG_C;  2YPG_E;  5E32_A;  5BNY_A;  5BNY_C;  5BNY_E;  4UO5_A;  4UO5_C;  4UO5_E;  4UO2_A;  4UO2_C;  4UO2_E;  4BSC_A;  4BGY_A;  4KPS_A;  4KPS_C;  4KPS_E;  5E30_A;  5E30_C;  5E30_E;  4N61_A;  4N61_C;  5W6R_A;  5W6R_C;  5W6R_E;  5W6R_G;  3M5G_A;  3M5G_C;  3M5G_E;  4LN3_A;  4LN3_C;  4LN3_E;  4LN3_G;  4LN3_I;  4LN3_K;  5W6T_A;  4KON_A;  3ZP2_E;  4DJ8_A;  4DJ8_C;  4DJ8_E;  3GBM_A;  3GBM_C;  5THC_A;  5THC_C;  5THC_E;  5VJL_A;  4BSI_A;  4LKK_A;  4YY0_A;  4YY0_C;  4YY0_E;  3ZNL_A;  3ZNL_C;  3ZNL_E;  4K62_A;  4K62_C;  4K62_E;  4K62_G;  3ZP6_E;  1EO8_A;  5BQY_A;  5BQY_C;  5BQY_E;  4UOA_A;  4KWM_A;  4KWM_C;  4KWM_E;  3EYM_A;  3EYM_C;  3EYM_E;  4JUG_A;  4JUG_C;  4JUG_E;  4JUG_G;  4JUG_I;  4JUG_K;  4K64_A;  4K64_C;  4K64_E;  4K64_G;  1HGE_A;  1HGE_C;  1HGE_E;  4JUL_A;  4JUL_C;  4JUL_E;  4JUL_H;  4JUL_J;  4JUL_L;  1QFU_A;  4EDB_A;  4EDB_C;  4EDB_E;  4KOM_A;  3ZP1_E;  4BGZ_A;  4BGZ_C;  4BGZ_E;  4BSE_A;  4WSU_A;  4WSU_C;  4WSU_E;  6FYT_A;  5E34_A;  4UO6_A;  5XRS_A;  5XRS_C;  5XRS_E;  5XRS_G;  3ZP0_E;  3ZPA_E;  3M5H_A;  3M5H_C;  3M5H_E;  4JUH_A;  4JUH_C;  4JUH_E;  4CQV_A;  4CQV_C;  4CQV_E;  4CQZ_A;  4H32_A;  4H32_C;  4H32_E;  4H32_G;  4H32_I;  4H32_K;  4UNY_A;  4UNY_C;  4UNY_E;  4CR0_A;  1HGJ_A;  1HGJ_C;  1HGJ_E;  4KDQ_A;  4KDQ_C;  4KDQ_E;  4KTH_A;  4KTH_C;  4KTH_E;  4PY8_A;  3SDY_A;  6D7U_A;  6D7U_C;  6D7U_E;  1HGI_A;  1HGI_C;  1HGI_E;  4N63_A;  4N63_C;  4DJ7_A;  4DJ7_C;  4DJ7_E;  1HGD_A;  1HGD_C;  1HGD_E;  3ZNK_A;  3ZNK_C;  3ZNK_E;  5TGV_A;  5TGV_C;  5TGV_E;  1HGH_A;  1HGH_C;  1HGH_E;  4UNZ_A;  4UNZ_C;  4UNZ_E;  5W08_A;  5W08_B;  5W08_C;  5W08_D;  5W08_E;  5W08_F;  4N5J_A;  4N5J_C;  4K67_A;  4K67_C;  4K67_E;  4K67_G;  4N64_A;  4N64_C;  5T0D_A;  5T0D_C;  5T0D_E;  6CF7_A;  5VJM_A;  5KAN_A;  5KAN_C;  5KAN_E;  4N5K_A;  4N5K_C;  3ZPB_E;  3ZP3_E;  5TG9_A;  5TG9_C;  5W6G_A;  4EEF_A;  4EEF_C;  4EEF_E;  5E35_A;  6ML8_A;  6E3H_A;  3HTT_A;  4BSF_A;  5VTQ_A;  5VTQ_C;  5VTQ_E;  4YY7_A;  4YY7_C;  4K65_A;  4K65_C;  4K65_E;  4K65_G;  4JUK_A;  4WSW_A;  4WSW_C;  4WSW_E;  5Y2L_A;  4EDA_A;  4EDA_C;  4GMS_A;  4GMS_C;  4GMS_E;  4LKI_A;  5VMJ_A;  5VMJ_C;  5VMJ_E;  4UO3_A;  4UO3_C;  4UO3_E;  4JUJ_A;  4JUJ_C;  4JUJ_E;  4HFU_A;  5HUF_A;  5HUF_C;  5HUF_E;  4LXV_A;  4LXV_C;  4LXV_E;  4LXV_G;  4LXV_I;  4LXV_K;  3M6S_A;  3M6S_C;  3M6S_E;  3M6S_G;  3M6S_I;  3M6S_K;  4WSX_A;  4WSX_C;  4WSX_E;  4WSX_G;  4WSX_I;  4WSX_K;  4WSX_M;  4WSX_O;  4WSX_Q;  4WSX_S;  4WSX_U;  4WSX_W;  3LZF_A;  3M5I_A;  3M5I_C;  3M5I_E;  4KOL_A;  4UO8_A;  3HTO_A;  1RUY_H;  1RUY_J;  1RUY_L;  4JTX_A;  4JTX_C;  4JTX_E;  4JTX_G;  4JTX_I;  4JTX_K;  3HTQ_A;  3HTP_A;  4LN4_A;  4LN4_C;  4LN4_E;  4LN4_G;  4LN4_I;  4LN4_K;  3QQO_A;  3QQO_C;  3QQO_E;  1MQM_A;  1MQM_D;  1MQM_G;  4N60_A;  4N60_C;  5BQZ_A;  5BQZ_C;  5BQZ_E;  4LKJ_A;  6N4F_A;  6N4F_C;  6N4F_E;  6N4F_G;  5XRT_A;  5XRT_C;  5XRT_E;  5XRT_G;  1HGG_A;  1HGG_C;  1HGG_E;  3ZTN_A;  3VUN_A;  3VUN_C;  3VUN_E;  4HLZ_A;  4HLZ_C;  4HLZ_E;  5W6U_A;  6NZ7_A;  6NZ7_E;  2IBX_A;  2IBX_C;  2IBX_E;  4K66_A;  4K66_C;  4K66_E;  4K66_G;  5W6I_A;  2HMG_A;  2HMG_C;  2HMG_E;  4W8N_A;  4W8N_C;  4W8N_E;  4YY1_A;  4YY1_C;  4I78_A;  4I78_B;  4JTV_A;  4JTV_C;  4JTV_E;  4JTV_G;  4JTV_I;  4JTV_K;  3HMG_C;  3HMG_E;  5GJT_A;  4LKH_A;  1TI8_A;  1HGF_A;  1HGF_C;  1HGF_E;  2WRH_H;  2WRH_J;  2WRH_L;  4N5Z_A;  4N5Z_C;  4N5Z_E;  4N5Z_G;  4N5Z_I;  4N5Z_K;  4N5Z_M;  4N5Z_O;  4N5Z_Q;  4N5Z_S;  4N5Z_U;  4N5Z_W;  4N5Z_Y;  4N5Z_a;  4N5Z_c;  3S12_A;  6D8B_A;  6D8B_C;  6D8B_E;  4HMG_A;  4HMG_C;  4HMG_E;  4N5Y_A;  4N5Y_C;  4N5Y_E;  4N5Y_G;  4N5Y_I;  4N5Y_K;  4N5Y_M;  4N5Y_O;  4N5Y_Q;  4N5Y_S;  4N5Y_U;  4N5Y_W;  4N5Y_Y;  4N5Y_a;  4N5Y_c;  6N5A_A;  3AL4_A;  3AL4_C;  3AL4_E;  3AL4_G;  3AL4_I;  3AL4_K;  4JU0_A;  4JU0_C;  4JU0_E;  4JU0_G;  4JU0_I;  4JU0_K;  6D7C_A;  6D7C_C;  6D7C_E;  6D7C_G;  6D7C_I;  6D7C_K;  4HF5_A;  5A3I_A;  5A3I_E;  6E7G_A;  6E7G_C;  6E7G_E;  3S13_A;  5TG8_A;  5TG8_C;  4UO7_A;  4UO7_C;  4UO7_E;  3R2X_A;  5UGY_A;  5UGY_C;  5UGY_E;  1RUZ_H;  1RUZ_J;  1RUZ_L;  6II8_A;  6II8_C;  6II8_E;  4LCX_A;  4LCX_C;  4LCX_E;  4R8W_A;  5HMG_A;  5HMG_C;  5HMG_E;  4UO9_A;  5GJS_A;  4XQO_A;  4XQO_C;  4XQO_E;  4XQU_A;  4XQU_C;  4XQU_E;  4LKG_A;  4LKG_C;  4LKG_E;  4ZCJ_A;  4ZCJ_C;  4ZCJ_E;  6II9_A;  6II9_C;  6II9_E;  4GXU_A;  4GXU_C;  4GXU_E;  4GXU_G;  4GXU_I;  4GXU_K;  5W42_A;  5IBL_B;  5IBL_F;  3FKU_A;  3FKU_C;  3FKU_E;  3FKU_G;  3FKU_I;  3FKU_K;  4MHH_A;  4MHH_C;  4MHH_E;  1MQL_A;  1MQL_D;  1MQL_G;  4F3Z_A;  4F3Z_C;  4F3Z_E;  4WSV_A;  4WSV_C;  4WSV_E;  4K63_A;  4K63_C;  4K63_E;  4K63_G;  6II4_A;  6II4_C;  1MQN_A;  1MQN_D;  1MQN_G;  4UBD_A;  4UBD_E;  4UBD_I;  4UBD_M;  4UBD_Q;  4UBD_U;  2FK0_A;  2FK0_C;  2FK0_E;  2FK0_G;  2FK0_I;  2FK0_K;  2FK0_M;  2FK0_O;  2FK0_Q;  5XHV_A;  5XHV_E;  2WRG_H;  2WRG_J;  2WRG_L;  1RD8_A;  1RD8_C;  1RD8_E;  6E7H_A;  6E7H_C;  6E7H_E;  4HG4_A;  4HG4_B;  4HG4_C;  4HG4_D;  4HG4_E;  4HG4_F;  4HG4_G;  4HG4_H;  4HG4_I;  6D8D_A;  6D8D_C;  6D8D_E;  3ZTJ_A;  3ZTJ_C;  3ZTJ_E;  4UO1_A;  4UO1_C;  4UO1_E;  5UG0_A;  4CZ0_A;  4CZ0_C;  4CZ0_E;  5JW3_A;  5WKO_M;  5WKO_N;  5WKO_O;  5WKO_S;  5WKO_T;  5WKO_U;  1KEN_A;  1KEN_C;  1KEN_E;  5Y2M_A;  5Y2M_B;  5Y2M_C;  4NM8_A;  4NM8_C;  4NM8_E;  5JW4_A;  5JW4_C;  5JW4_E;  5JW4_G;  5JW4_I;  5JW4_K;  4UNX_A;  4UNX_C;  4UNX_E;  6B3M_A;  6B3M_E;  6B3M_G;  6B3M_K;  6B3M_Q;  6B3M_S;  5V2A_A;  4O5I_A;  4O5I_C;  4O5I_E;  4O5I_G;  4O5I_I;  4O5I_K;  4FQR_A;  4FQR_C;  4FQR_E;  4FQR_G;  4FQR_I;  4FQR_K;  4FQR_M;  4FQR_O;  4FQR_Q;  4FQR_S;  4FQR_U;  4FQR_W;  4FQV_A;  4FQV_C;  4FQV_E;  4FQY_A;  4MHJ_A;  4MHJ_C;  4MHJ_G;  4MHJ_M;  4MHJ_O;  4MHJ_S;  6MLM_A;  6MLM_B;  6MLM_H;  6HJN_A;  6HJN_C;  6HJN_E;  6HJP_A;  6HJP_C;  6HJP_E;  6HJQ_A;  6HJQ_C;  6HJQ_E;  6HJR_A;  6HJR_C;  6HJR_E;  5UJZ_A;  5UJZ_C;  5UJZ_E;  5UK0_A;  5UK0_C;  5UK0_E;  5UK1_A;  5UK1_C;  5UK1_E;  5UK2_A;  5UK2_C;  5UK2_E;  3KU3_B;  6AOR_B;  6BKR_B;  6NSB_B;  4O5N_B;  6AOU_B;  6AOV_B;  6BKS_B;  3KU5_B;  4FQI_B;  6BKT_B;  3KU6_B;  6BKO_B;  4GXX_B;  4GXX_D;  4GXX_F;  6BKN_B;  5VLI_B;  4FNK_B;  4FNK_D;  4FNK_F;  6NS9_B;  1JSD_B;  4BH4_B;  4UO0_B;  4UO0_D;  4UO0_F;  6NSA_B;  6AOT_B;  4JUM_B;  3QQB_B;  4BH3_B;  3UBQ_B;  3UBQ_D;  3UBQ_F;  3UBQ_H;  3UBQ_J;  3UBQ_L;  6CF5_B;  6CF5_D;  6CF5_F;  6BKP_B;  4CQY_B;  4CQY_D;  4CQY_F;  6NSF_B;  1JSM_B;  4WE5_B;  5VTZ_B;  5VTZ_D;  5VTZ_F;  5VMC_B;  5VMC_D;  5VMC_F;  5XL4_C;  5XL4_D;  3QQE_B;  5T0B_B;  5T0B_D;  5T0B_F;  4K3X_B;  4K3X_D;  4K3X_F;  4M4Y_B;  4M4Y_D;  4M4Y_F;  6BKM_B;  6BKM_D;  6BKM_F;  3UBE_B;  3UBE_D;  3UBE_F;  3UBE_H;  3UBE_J;  3UBE_L;  5XL7_C;  5XL7_D;  6BKQ_B;  6BKQ_D;  6BKQ_F;  5TH1_B;  5TH1_D;  5TH1_F;  5T0E_B;  5T0E_D;  5T0E_F;  5VU4_B;  5VU4_D;  5VU4_F;  5VTV_B;  5VTV_D;  5VTV_F;  4BH1_B;  4BH1_D;  4BH1_F;  4BH2_B;  5XL5_C;  5XL5_D;  4BSG_B;  3GBN_B;  4CQX_B;  4CQX_D;  4CQX_F;  5W5S_B;  6NSC_B;  5XL1_C;  5XL1_D;  5VTY_B;  5VTY_D;  5VTY_F;  3UBJ_B;  3UBJ_D;  3UBJ_F;  3UBJ_H;  3UBJ_J;  3UBJ_L;  5XL3_C;  5XL3_D;  5T08_B;  5T08_D;  5T08_F;  4CQW_B;  4CQW_D;  4CQW_F;  6AOP_B;  5BR0_B;  5BR0_D;  4XKG_B;  4XKG_D;  4XKG_F;  4LN6_B;  4LN6_D;  4LN6_F;  4LN6_H;  4LN6_J;  4LN6_L;  5THB_B;  5THB_D;  5THB_F;  5VTW_B;  5VTW_D;  5VTW_F;  5VMF_B;  5VMF_D;  5VMF_F;  4WE4_B;  5TH0_B;  5TH0_D;  5TH0_F;  5TGU_B;  5TGU_D;  5TGU_F;  1RVX_B;  1RVX_D;  1RVX_F;  1RVX_H;  1RVX_J;  1RVX_L;  6NSG_B;  6AOS_B;  4QY2_B;  4QY2_D;  4QY2_F;  4QY2_H;  4QY2_J;  4QY2_L;  6CFG_B;  4JUN_B;  4JUN_D;  4JUN_F;  5TGO_B;  5TGO_D;  5TGO_F;  1RVZ_B;  1RVZ_D;  1RVZ_F;  1RVZ_H;  1RVZ_J;  1RVZ_L;  4CYV_B;  4CYV_D;  4CYV_F;  5XLD_C;  5XLD_D;  5T6S_B;  5T6S_D;  5T6S_F;  5T6S_H;  5T6S_J;  5T6S_L;  6CEX_B;  6CEX_D;  6CEX_F;  1JSH_B;  5K9Q_B;  5K9Q_D;  5K9Q_F;  5K9Q_N;  5K9Q_P;  5K9Q_R;  5HU8_B;  5HU8_D;  5HU8_F;  5VMG_B;  5VMG_D;  5VMG_F;  1JSI_B;  4BSH_B;  5VTR_B;  5VTR_D;  5VTR_F;  5T6N_B;  5T6N_D;  5T6N_F;  5KUY_B;  5KUY_D;  5KUY_F;  4BH0_B;  4BH0_D;  4BH0_F;  4CYZ_B;  4CYZ_D;  4CYZ_F;  5VTU_B;  5VTU_D;  5VTU_F;  4BGX_B;  6AOQ_B;  5BR6_B;  5BR6_D;  5AJM_B;  4CQR_B;  4KW1_B;  4KW1_D;  4KW1_F;  4KW1_H;  3EYK_B;  5XL6_C;  5XL6_D;  5XLC_C;  5XLC_D;  4YYA_B;  3LZG_B;  3LZG_D;  3LZG_F;  3LZG_H;  3LZG_J;  3LZG_L;  1RU7_B;  1RU7_D;  1RU7_F;  1RU7_H;  1RU7_J;  1RU7_L;  4CQU_B;  4UNW_B;  4UNW_D;  4UNW_F;  5THF_B;  5THF_D;  5THF_F;  4XKF_B;  4XKF_D;  4XKF_F;  1JSO_B;  4CQS_B;  4BSB_B;  5W5U_B;  4XKD_B;  4XKD_D;  4XKD_F;  4MHI_B;  4MHI_D;  4MHI_F;  4MHI_H;  4MHI_J;  4MHI_L;  4MHI_N;  4MHI_P;  4MHI_R;  4WST_B;  4WST_D;  4WST_F;  4WST_H;  4WST_J;  4WST_L;  4CQQ_B;  4BGW_B;  4XQ5_B;  4XQ5_D;  4XQ5_F;  4XKE_B;  4XKE_D;  4XKE_F;  3UBN_B;  3UBN_D;  3UBN_F;  3UBN_H;  3UBN_J;  3UBN_L;  4YY9_B;  6FYU_B;  6FYU_H;  6FYU_E;  4D00_B;  4D00_D;  4D00_F;  5BR3_B;  5BR3_D;  2VIU_B;  4YYB_B;  3EYJ_B;  4QY0_B;  4QY0_D;  4QY0_F;  4QY0_H;  4QY0_J;  4QY0_L;  5E2Y_B;  5E2Y_D;  5E2Y_F;  1RV0_I;  1RV0_K;  1RV0_M;  4QY1_B;  4QY1_D;  4QY1_F;  4QY1_H;  4QY1_J;  4QY1_L;  4QY1_N;  4QY1_P;  4QY1_R;  4QY1_T;  4QY1_V;  4QY1_X;  4UO4_B;  4O58_B;  4KDM_B;  4KDM_D;  4KDM_F;  1RVT_I;  1RVT_K;  1RVT_M;  4BSA_B;  4CQP_B;  4LN8_B;  4LN8_D;  4LN8_F;  4LN8_H;  4LN8_J;  4LN8_L;  5VJK_B;  5XLB_C;  5XLB_D;  5VTX_B;  5VTX_D;  5VTX_F;  4KDO_B;  4KDO_D;  4KDO_F;  3M5J_B;  3M5J_D;  3M5J_F;  4DJ6_B;  4DJ6_D;  4DJ6_F;  3ZNM_B;  3ZNM_D;  3ZNM_F;  4KDN_B;  4KDN_D;  4KDN_F;  4BSD_B;  4N62_B;  4N62_D;  3S11_B;  3S11_D;  3S11_F;  1JSN_B;  5E2Z_B;  5E2Z_D;  5E2Z_F;  4KPQ_B;  4KPQ_D;  4KPQ_F;  4CYW_B;  4CYW_D;  4CYW_F;  2YPG_B;  2YPG_D;  2YPG_F;  5E32_B;  5BNY_B;  5BNY_D;  5BNY_F;  4UO5_B;  4UO5_D;  4UO5_F;  4UO2_B;  4UO2_D;  4UO2_F;  4BSC_B;  4BGY_B;  4KPS_B;  4KPS_D;  4KPS_F;  5E30_B;  5E30_D;  5E30_F;  4N61_B;  4N61_D;  5W6R_B;  5W6R_D;  5W6R_F;  5W6R_H;  3M5G_B;  3M5G_D;  3M5G_F;  4LN3_B;  4LN3_D;  4LN3_F;  4LN3_H;  4LN3_J;  4LN3_L;  5W6T_B;  4KON_B;  3ZP2_F;  4DJ8_B;  4DJ8_D;  4DJ8_F;  3GBM_B;  3GBM_D;  5THC_B;  5THC_D;  5THC_F;  5VJL_B;  4BSI_B;  4LKK_B;  4YY0_B;  4YY0_D;  4YY0_F;  3ZNL_B;  3ZNL_D;  3ZNL_F;  4K62_B;  4K62_D;  4K62_F;  4K62_H;  3ZP6_F;  1EO8_B;  5BQY_B;  5BQY_D;  5BQY_F;  4UOA_B;  4KWM_B;  4KWM_D;  4KWM_F;  3EYM_B;  3EYM_D;  3EYM_F;  4JUG_B;  4JUG_D;  4JUG_F;  4JUG_H;  4JUG_J;  4JUG_L;  4K64_B;  4K64_D;  4K64_F;  4K64_H;  1HGE_B;  1HGE_D;  1HGE_F;  4JUL_B;  4JUL_D;  4JUL_F;  4JUL_I;  4JUL_K;  4JUL_M;  1QFU_B;  4EDB_B;  4EDB_D;  4EDB_F;  4KOM_B;  3ZP1_F;  4BGZ_B;  4BGZ_D;  4BGZ_F;  4BSE_B;  4WSU_B;  4WSU_D;  4WSU_F;  6FYT_B;  5E34_B;  4UO6_B;  5XRS_B;  5XRS_D;  5XRS_F;  5XRS_H;  3ZP0_F;  3ZPA_F;  3M5H_B;  3M5H_D;  3M5H_F;  4JUH_B;  4JUH_D;  4JUH_F;  4CQV_B;  4CQV_D;  4CQV_F;  4CQZ_B;  4H32_B;  4H32_D;  4H32_F;  4H32_H;  4H32_J;  4H32_L;  4UNY_B;  4UNY_D;  4UNY_F;  4CR0_B;  1HGJ_B;  1HGJ_D;  1HGJ_F;  4KDQ_B;  4KDQ_D;  4KDQ_F;  4KTH_B;  4KTH_D;  4KTH_F;  4PY8_B;  3SDY_B;  6D7U_B;  6D7U_D;  6D7U_F;  1HGI_B;  1HGI_D;  1HGI_F;  4N63_B;  4N63_D;  4DJ7_B;  4DJ7_D;  4DJ7_F;  1HGD_B;  1HGD_D;  1HGD_F;  3ZNK_B;  3ZNK_D;  3ZNK_F;  5TGV_B;  5TGV_D;  5TGV_F;  1HGH_B;  1HGH_D;  1HGH_F;  4UNZ_B;  4UNZ_D;  4UNZ_F;  4N5J_B;  4N5J_D;  4K67_B;  4K67_D;  4K67_F;  4K67_H;  4N64_B;  4N64_D;  5T0D_B;  5T0D_D;  5T0D_F;  6CF7_B;  5VJM_B;  5KAN_B;  5KAN_D;  5KAN_F;  4N5K_B;  4N5K_D;  3ZPB_F;  3ZP3_F;  5TG9_B;  5TG9_D;  5W6G_B;  4EEF_B;  4EEF_D;  4EEF_F;  5E35_B;  6ML8_B;  6E3H_B;  3HTT_B;  4BSF_B;  5VTQ_B;  5VTQ_D;  5VTQ_F;  4YY7_B;  4YY7_D;  4K65_B;  4K65_D;  4K65_F;  4K65_H;  4JUK_B;  4WSW_B;  4WSW_D;  4WSW_F;  5Y2L_B;  4EDA_B;  4EDA_D;  4GMS_B;  4GMS_D;  4GMS_F;  4LKI_B;  5VMJ_B;  5VMJ_D;  5VMJ_F;  4UO3_B;  4UO3_D;  4UO3_F;  4JUJ_B;  4JUJ_D;  4JUJ_F;  4HFU_B;  5HUF_B;  5HUF_D;  5HUF_F;  4LXV_B;  4LXV_D;  4LXV_F;  4LXV_H;  4LXV_J;  4LXV_L;  3M6S_B;  3M6S_D;  3M6S_F;  3M6S_H;  3M6S_J;  3M6S_L;  4WSX_B;  4WSX_D;  4WSX_F;  4WSX_H;  4WSX_J;  4WSX_L;  4WSX_N;  4WSX_P;  4WSX_R;  4WSX_T;  4WSX_V;  4WSX_X;  3LZF_B;  3M5I_B;  3M5I_D;  3M5I_F;  4KOL_B;  4UO8_B;  3HTO_B;  1RUY_I;  1RUY_K;  1RUY_M;  4JTX_B;  4JTX_D;  4JTX_F;  4JTX_H;  4JTX_J;  4JTX_L;  3HTQ_B;  3HTP_B;  4LN4_B;  4LN4_D;  4LN4_F;  4LN4_H;  4LN4_J;  4LN4_L;  3QQO_B;  3QQO_D;  3QQO_F;  4N60_B;  4N60_D;  5BQZ_B;  5BQZ_D;  5BQZ_F;  4LKJ_B;  6N4F_B;  6N4F_D;  6N4F_F;  6N4F_H;  5XRT_B;  5XRT_D;  5XRT_F;  5XRT_H;  1HGG_B;  1HGG_D;  1HGG_F;  3ZTN_B;  3VUN_B;  3VUN_D;  3VUN_F;  4HLZ_B;  4HLZ_D;  4HLZ_F;  5W6U_B;  6NZ7_B;  6NZ7_F;  2IBX_B;  2IBX_D;  2IBX_F;  4K66_B;  4K66_D;  4K66_F;  4K66_H;  5W6I_B;  2HMG_B;  2HMG_D;  2HMG_F;  4W8N_B;  4W8N_D;  4W8N_F;  4YY1_B;  4YY1_D;  4I78_C;  4I78_D;  4JTV_B;  4JTV_D;  4JTV_F;  4JTV_H;  4JTV_J;  4JTV_L;  3HMG_D;  3HMG_F;  5GJT_B;  4LKH_B;  1TI8_B;  1HGF_B;  1HGF_D;  1HGF_F;  4N5Z_B;  4N5Z_D;  4N5Z_F;  4N5Z_H;  4N5Z_J;  4N5Z_L;  4N5Z_N;  4N5Z_P;  4N5Z_R;  4N5Z_T;  4N5Z_V;  4N5Z_X;  4N5Z_Z;  4N5Z_b;  4N5Z_d;  3S12_B;  4HMG_B;  4HMG_D;  4HMG_F;  4N5Y_B;  4N5Y_D;  4N5Y_F;  4N5Y_H;  4N5Y_J;  4N5Y_L;  4N5Y_N;  4N5Y_P;  4N5Y_R;  4N5Y_T;  4N5Y_V;  4N5Y_X;  4N5Y_Z;  4N5Y_b;  4N5Y_d;  6N5A_B;  3AL4_B;  3AL4_D;  3AL4_F;  3AL4_H;  3AL4_J;  3AL4_L;  4JU0_B;  4JU0_D;  4JU0_F;  4JU0_H;  4JU0_J;  4JU0_L;  4HF5_B;  5A3I_B;  5A3I_F;  6E7G_B;  6E7G_D;  6E7G_F;  3S13_B;  5TG8_B;  5TG8_D;  4UO7_B;  4UO7_D;  4UO7_F;  3R2X_B;  5UGY_B;  5UGY_D;  5UGY_F;  1RUZ_I;  1RUZ_K;  1RUZ_M;  6II8_B;  6II8_D;  6II8_F;  4LCX_B;  4LCX_D;  4LCX_F;  4R8W_B;  5HMG_B;  5HMG_D;  5HMG_F;  4UO9_B;  5GJS_B;  4XQO_B;  4XQO_D;  4XQO_F;  4XQU_B;  4XQU_D;  4XQU_F;  4LKG_B;  4LKG_D;  4LKG_F;  4ZCJ_B;  4ZCJ_D;  4ZCJ_F;  6II9_B;  6II9_D;  6II9_F;  4GXU_B;  4GXU_D;  4GXU_F;  4GXU_H;  4GXU_J;  4GXU_L;  5W42_B;  5IBL_A;  5IBL_E;  3FKU_B;  3FKU_D;  3FKU_F;  3FKU_H;  3FKU_J;  3FKU_L;  4MHH_B;  4MHH_D;  4MHH_F;  4F3Z_B;  4F3Z_D;  4F3Z_F;  4WSV_B;  4WSV_D;  4WSV_F;  4K63_B;  4K63_D;  4K63_F;  4K63_H;  6II4_B;  6II4_D;  4UBD_B;  4UBD_F;  4UBD_J;  4UBD_N;  4UBD_R;  4UBD_V;  2FK0_B;  2FK0_D;  2FK0_F;  2FK0_H;  2FK0_J;  2FK0_L;  2FK0_N;  2FK0_P;  2FK0_R;  1RD8_B;  1RD8_D;  1RD8_F;  6E7H_B;  6E7H_D;  6E7H_F;  4HG4_a;  4HG4_b;  4HG4_c;  4HG4_d;  4HG4_e;  4HG4_f;  4HG4_g;  4HG4_h;  4HG4_i;  3ZTJ_B;  3ZTJ_D;  3ZTJ_F;  4UO1_B;  4UO1_D;  4UO1_F;  5UG0_B;  4CZ0_B;  4CZ0_D;  4CZ0_F;  5JW3_B;  5WKO_P;  5WKO_Q;  5WKO_R;  5WKO_V;  5WKO_W;  5WKO_X;  1KEN_B;  1KEN_D;  1KEN_F;  5Y2M_D;  5Y2M_E;  5Y2M_F;  4NM8_B;  4NM8_D;  4NM8_F;  5JW4_B;  5JW4_D;  5JW4_F;  5JW4_H;  5JW4_J;  5JW4_L;  4UNX_B;  4UNX_D;  4UNX_F;  5CJS_D;  5CJS_K;  6B3M_B;  6B3M_F;  6B3M_H;  6B3M_L;  6B3M_R;  6B3M_T;  5V2A_B;  4O5I_B;  4O5I_D;  4O5I_F;  4O5I_H;  4O5I_J;  4O5I_L;  4FQR_B;  4FQR_D;  4FQR_F;  4FQR_H;  4FQR_J;  4FQR_L;  4FQR_N;  4FQR_P;  4FQR_R;  4FQR_T;  4FQR_V;  4FQR_X;  5CJQ_B;  4FQV_B;  4FQV_D;  4FQV_F;  4FQY_B;  4MHJ_B;  4MHJ_D;  4MHJ_I;  4MHJ_N;  4MHJ_P;  4MHJ_U;  6HJN_B;  6HJN_D;  6HJN_F;  6HJP_B;  6HJP_D;  6HJP_F;  5UJZ_B;  5UJZ_D;  5UJZ_F;  5UK0_B;  5UK0_D;  5UK0_F;  5UK1_B;  5UK1_D;  5UK1_F;  5UK2_B;  5UK2_D;  5UK2_F;  3KU3_A;  6AOR_A;  6BKR_A;  6NSB_A;  4O5N_A;  6AOU_A;  6AOV_A;  6BKS_A;  3KU5_A;  4FQI_A;  6BKT_A;  3KU6_A;  6BKO_A;  4GXX_A;  4GXX_C;  4GXX_E;  6BKN_A;  5VLI_A;  4FNK_A;  4FNK_C;  4FNK_E;  5XKU_A;  4WE6_A;  4WE6_B;  6NS9_A;  1JSD_A;  4BH4_A;  5VAG_A;  4UO0_A;  4UO0_C;  4UO0_E;  6NSA_A;  6AOT_A;  4JUM_A;  3QQB_A;  4BH3_A;  3UBQ_A;  3UBQ_C;  3UBQ_E;  3UBQ_G;  3UBQ_I;  3UBQ_K;  6CF5_A;  6CF5_C;  6CF5_E;  6BKP_A;  4CQY_A;  4CQY_C;  4CQY_E;  6NSF_A;  1JSM_A;  4WE5_A;  5VTZ_A;  5VTZ_C;  5VTZ_E;  5VMC_A;  5VMC_C;  5VMC_E;  5XL4_A;  5XL4_B;  3QQE_A;  5T0B_A;  5T0B_C;  5T0B_E;  4K3X_A;  4K3X_C;  4K3X_E;  4M4Y_A;  4M4Y_C;  4M4Y_E;  6BKM_A;  6BKM_C;  6BKM_E;  3UBE_A;  3UBE_C;  3UBE_E;  3UBE_G;  3UBE_I;  3UBE_K;  5XL7_A;  5XL7_B;  6BKQ_A;  6BKQ_C;  6BKQ_E;  5TH1_A;  5TH1_C;  5TH1_E;  5T0E_A;  5T0E_C;  5T0E_E;  5VU4_A;  5VU4_C;  5VU4_E;  5VTV_A;  5VTV_C;  5VTV_E;  4BH1_A;  4BH1_C;  4BH1_E;  4BH2_A;  5XL5_A;  5XL5_B;  4BSG_A;  3GBN_A;  4CQX_A;  4CQX_C;  4CQX_E;  5W5S_A;  6NSC_A;  5XL1_A;  5XL1_B;  5VTY_A;  5VTY_C;  5VTY_E;  6E4X_B;  3UBJ_A;  3UBJ_C;  3UBJ_E;  3UBJ_G;  3UBJ_I;  3UBJ_K;  5XL3_A;  5XL3_B;  5T08_A;  5T08_C;  5T08_E;  4CQW_A;  4CQW_C;  4CQW_E;  6AOP_A;  5BR0_A;  5BR0_C;  4XKG_A;  4XKG_C;  4XKG_E;  4LN6_A;  4LN6_C;  4LN6_E;  4LN6_G;  4LN6_I;  4LN6_K;  5THB_A;  5THB_C;  5THB_E;  5VTW_A;  5VTW_C;  5VTW_E;  5VMF_A;  5VMF_C;  5VMF_E;  4WE4_A;  5TH0_A;  5TH0_C;  5TH0_E;  5TGU_A;  5TGU_C;  5TGU_E;  1RVX_A;  1RVX_C;  1RVX_E;  1RVX_G;  1RVX_I;  1RVX_K;  6NSG_A;  6AOS_A;  4QY2_A;  4QY2_C;  4QY2_E;  4QY2_G;  4QY2_I;  4QY2_K;  6CFG_A;  4JUN_A;  4JUN_C;  4JUN_E;  5TGO_A;  5TGO_C;  5TGO_E;  1RVZ_A;  1RVZ_C;  1RVZ_E;  1RVZ_G;  1RVZ_I;  1RVZ_K;  4CYV_A;  4CYV_C;  4CYV_E;  5XLD_A;  5XLD_B;  5T6S_A;  5T6S_C;  5T6S_E;  5T6S_G;  5T6S_I;  5T6S_K;  6CEX_A;  6CEX_C;  6CEX_E;  1JSH_A;  5K9Q_A;  5K9Q_C;  5K9Q_E;  5K9Q_M;  5K9Q_O;  5K9Q_Q;  5HU8_A;  5HU8_C;  5HU8_E;  5VMG_A;  5VMG_C;  5VMG_E;  1JSI_A;  4BSH_A;  5VTR_A;  5VTR_C;  5VTR_E;  5T6N_A;  5T6N_C;  5T6N_E;  5KUY_A;  5KUY_C;  5KUY_E;  4BH0_A;  4BH0_C;  4BH0_E;  4CYZ_A;  4CYZ_C;  4CYZ_E;  5VTU_A;  5VTU_C;  5VTU_E;  4BGX_A;  6AOQ_A;  5BR6_A;  5BR6_C;  5AJM_A;  4CQR_A;  4KW1_A;  4KW1_C;  4KW1_E;  4KW1_G;  3EYK_A;  5XL6_A;  5XL6_B;  5XLC_A;  5XLC_B;  4YYA_A;  3LZG_A;  3LZG_C;  3LZG_E;  3LZG_G;  3LZG_I;  3LZG_K;  1RU7_A;  1RU7_C;  1RU7_E;  1RU7_G;  1RU7_I;  1RU7_K;  4CQU_A;  4UNW_A;  4UNW_C;  4UNW_E;  5THF_A;  5THF_C;  5THF_E;  4XKF_A;  4XKF_C;  4XKF_E;  1JSO_A;  4CQS_A;  4BSB_A;  5W5U_A;  4XKD_A;  4XKD_C;  4XKD_E;  4MHI_A;  4MHI_C;  4MHI_E;  4MHI_G;  4MHI_I;  4MHI_K;  4MHI_M;  4MHI_O;  4MHI_Q;  4WST_A;  4WST_C;  4WST_E;  4WST_G;  4WST_I;  4WST_K;  4CQQ_A;  4BGW_A;  4XQ5_A;  4XQ5_C;  4XQ5_E;  4XKE_A;  4XKE_C;  4XKE_E;  3UBN_A;  3UBN_C;  3UBN_E;  3UBN_G;  3UBN_I;  3UBN_K;  4YY9_A;  6FYU_A;  6FYU_D;  6FYU_G;  4D00_A;  4D00_C;  4D00_E;  5BR3_A;  5BR3_C;  2VIU_A;  4YYB_A;  3EYJ_A;  4QY0_A;  4QY0_C;  4QY0_E;  4QY0_G;  4QY0_I;  4QY0_K;  5E2Y_A;  5E2Y_C;  5E2Y_E;  1RV0_H;  1RV0_J;  1RV0_L;  4QY1_A;  4QY1_C;  4QY1_E;  4QY1_G;  4QY1_I;  4QY1_K;  4QY1_M;  4QY1_O;  4QY1_Q;  4QY1_S;  4QY1_U;  4QY1_W;  4UO4_A;  4O58_A;  4KDM_A;  4KDM_C;  4KDM_E;  1RVT_H;  1RVT_J;  1RVT_L;  4BSA_A;  4CQP_A;  4LN8_A;  4LN8_C;  4LN8_E;  4LN8_G;  4LN8_I;  4LN8_K;  5VJK_A;  5XLB_A;  5XLB_B;  5VTX_A;  5VTX_C;  5VTX_E;  4WE7_A;  4WE7_B;  4WE7_C;  4WE7_D;  4KDO_A;  4KDO_C;  4KDO_E;  3M5J_A;  3M5J_C;  3M5J_E;  4DJ6_A;  4DJ6_C;  4DJ6_E;  3ZNM_A;  3ZNM_C;  3ZNM_E;  4KDN_A;  4KDN_C;  4KDN_E;  4BSD_A;  4N62_A;  4N62_C;  3S11_A;  3S11_C;  3S11_E;  1JSN_A;  5E2Z_A;  5E2Z_C;  5E2Z_E;  4KPQ_A;  4KPQ_C;  4KPQ_E;  4CYW_A;  4CYW_C;  4CYW_E;  2YPG_A;  2YPG_C;  2YPG_E;  5E32_A;  5BNY_A;  5BNY_C;  5BNY_E;  4UO5_A;  4UO5_C;  4UO5_E;  4UO2_A;  4UO2_C;  4UO2_E;  4BSC_A;  4BGY_A;  4KPS_A;  4KPS_C;  4KPS_E;  5E30_A;  5E30_C;  5E30_E;  4N61_A;  4N61_C;  5W6R_A;  5W6R_C;  5W6R_E;  5W6R_G;  3M5G_A;  3M5G_C;  3M5G_E;  4LN3_A;  4LN3_C;  4LN3_E;  4LN3_G;  4LN3_I;  4LN3_K;  5W6T_A;  4KON_A;  3ZP2_E;  4DJ8_A;  4DJ8_C;  4DJ8_E;  3GBM_A;  3GBM_C;  5THC_A;  5THC_C;  5THC_E;  5VJL_A;  4BSI_A;  4LKK_A;  4YY0_A;  4YY0_C;  4YY0_E;  3ZNL_A;  3ZNL_C;  3ZNL_E;  4K62_A;  4K62_C;  4K62_E;  4K62_G;  3ZP6_E;  1EO8_A;  5BQY_A;  5BQY_C;  5BQY_E;  4UOA_A;  4KWM_A;  4KWM_C;  4KWM_E;  3EYM_A;  3EYM_C;  3EYM_E;  4JUG_A;  4JUG_C;  4JUG_E;  4JUG_G;  4JUG_I;  4JUG_K;  4K64_A;  4K64_C;  4K64_E;  4K64_G;  1HGE_A;  1HGE_C;  1HGE_E;  4JUL_A;  4JUL_C;  4JUL_E;  4JUL_H;  4JUL_J;  4JUL_L;  1QFU_A;  4EDB_A;  4EDB_C;  4EDB_E;  4KOM_A;  3ZP1_E;  4BGZ_A;  4BGZ_C;  4BGZ_E;  4BSE_A;  4WSU_A;  4WSU_C;  4WSU_E;  6FYT_A;  5E34_A;  4UO6_A;  5XRS_A;  5XRS_C;  5XRS_E;  5XRS_G;  3ZP0_E;  3ZPA_E;  3M5H_A;  3M5H_C;  3M5H_E;  4JUH_A;  4JUH_C;  4JUH_E;  4CQV_A;  4CQV_C;  4CQV_E;  4CQZ_A;  4H32_A;  4H32_C;  4H32_E;  4H32_G;  4H32_I;  4H32_K;  4UNY_A;  4UNY_C;  4UNY_E;  4CR0_A;  1HGJ_A;  1HGJ_C;  1HGJ_E;  4KDQ_A;  4KDQ_C;  4KDQ_E;  4KTH_A;  4KTH_C;  4KTH_E;  4PY8_A;  3SDY_A;  6D7U_A;  6D7U_C;  6D7U_E;  1HGI_A;  1HGI_C;  1HGI_E;  4N63_A;  4N63_C;  4DJ7_A;  4DJ7_C;  4DJ7_E;  1HGD_A;  1HGD_C;  1HGD_E;  3ZNK_A;  3ZNK_C;  3ZNK_E;  5TGV_A;  5TGV_C;  5TGV_E;  1HGH_A;  1HGH_C;  1HGH_E;  4UNZ_A;  4UNZ_C;  4UNZ_E;  5W08_A;  5W08_B;  5W08_C;  5W08_D;  5W08_E;  5W08_F;  4N5J_A;  4N5J_C;  4K67_A;  4K67_C;  4K67_E;  4K67_G;  4N64_A;  4N64_C;  5T0D_A;  5T0D_C;  5T0D_E;  6CF7_A;  5VJM_A;  5KAN_A;  5KAN_C;  5KAN_E;  4N5K_A;  4N5K_C;  3ZPB_E;  3ZP3_E;  5TG9_A;  5TG9_C;  5W6G_A;  4EEF_A;  4EEF_C;  4EEF_E;  5E35_A;  6ML8_A;  6E3H_A;  3HTT_A;  4BSF_A;  5VTQ_A;  5VTQ_C;  5VTQ_E;  4YY7_A;  4YY7_C;  4K65_A;  4K65_C;  4K65_E;  4K65_G;  4JUK_A;  4WSW_A;  4WSW_C;  4WSW_E;  5Y2L_A;  4EDA_A;  4EDA_C;  4GMS_A;  4GMS_C;  4GMS_E;  4LKI_A;  5VMJ_A;  5VMJ_C;  5VMJ_E;  4UO3_A;  4UO3_C;  4UO3_E;  4JUJ_A;  4JUJ_C;  4JUJ_E;  4HFU_A;  5HUF_A;  5HUF_C;  5HUF_E;  4LXV_A;  4LXV_C;  4LXV_E;  4LXV_G;  4LXV_I;  4LXV_K;  3M6S_A;  3M6S_C;  3M6S_E;  3M6S_G;  3M6S_I;  3M6S_K;  4WSX_A;  4WSX_C;  4WSX_E;  4WSX_G;  4WSX_I;  4WSX_K;  4WSX_M;  4WSX_O;  4WSX_Q;  4WSX_S;  4WSX_U;  4WSX_W;  3LZF_A;  3M5I_A;  3M5I_C;  3M5I_E;  4KOL_A;  4UO8_A;  3HTO_A;  1RUY_H;  1RUY_J;  1RUY_L;  4JTX_A;  4JTX_C;  4JTX_E;  4JTX_G;  4JTX_I;  4JTX_K;  3HTQ_A;  3HTP_A;  4LN4_A;  4LN4_C;  4LN4_E;  4LN4_G;  4LN4_I;  4LN4_K;  3QQO_A;  3QQO_C;  3QQO_E;  1MQM_A;  1MQM_D;  1MQM_G;  4N60_A;  4N60_C;  5BQZ_A;  5BQZ_C;  5BQZ_E;  4LKJ_A;  6N4F_A;  6N4F_C;  6N4F_E;  6N4F_G;  5XRT_A;  5XRT_C;  5XRT_E;  5XRT_G;  1HGG_A;  1HGG_C;  1HGG_E;  3ZTN_A;  3VUN_A;  3VUN_C;  3VUN_E;  4HLZ_A;  4HLZ_C;  4HLZ_E;  5W6U_A;  6NZ7_A;  6NZ7_E;  2IBX_A;  2IBX_C;  2IBX_E;  4K66_A;  4K66_C;  4K66_E;  4K66_G;  5W6I_A;  2HMG_A;  2HMG_C;  2HMG_E;  4W8N_A;  4W8N_C;  4W8N_E;  4YY1_A;  4YY1_C;  4I78_A;  4I78_B;  4JTV_A;  4JTV_C;  4JTV_E;  4JTV_G;  4JTV_I;  4JTV_K;  3HMG_A;  3HMG_C;  5GJT_A;  4LKH_A;  1TI8_A;  1HGF_A;  1HGF_C;  1HGF_E;  2WRH_H;  2WRH_J;  2WRH_L;  4N5Z_A;  4N5Z_C;  4N5Z_E;  4N5Z_G;  4N5Z_I;  4N5Z_K;  4N5Z_M;  4N5Z_O;  4N5Z_Q;  4N5Z_S;  4N5Z_U;  4N5Z_W;  4N5Z_Y;  4N5Z_a;  4N5Z_c;  3S12_A;  6D8B_A;  6D8B_C;  6D8B_E;  4HMG_A;  4HMG_C;  4HMG_E;  4N5Y_A;  4N5Y_C;  4N5Y_E;  4N5Y_G;  4N5Y_I;  4N5Y_K;  4N5Y_M;  4N5Y_O;  4N5Y_Q;  4N5Y_S;  4N5Y_U;  4N5Y_W;  4N5Y_Y;  4N5Y_a;  4N5Y_c;  6N5A_A;  3AL4_A;  3AL4_C;  3AL4_E;  3AL4_G;  3AL4_I;  3AL4_K;  4JU0_A;  4JU0_C;  4JU0_E;  4JU0_G;  4JU0_I;  4JU0_K;  6D7C_A;  6D7C_C;  6D7C_E;  6D7C_G;  6D7C_I;  6D7C_K;  4HF5_A;  5A3I_A;  5A3I_E;  6E7G_A;  6E7G_C;  6E7G_E;  3S13_A;  5TG8_A;  5TG8_C;  4UO7_A;  4UO7_C;  4UO7_E;  3R2X_A;  5UGY_A;  5UGY_C;  5UGY_E;  1RUZ_H;  1RUZ_J;  1RUZ_L;  6II8_A;  6II8_C;  6II8_E;  4LCX_A;  4LCX_C;  4LCX_E;  4R8W_A;  5HMG_A;  5HMG_C;  5HMG_E;  4UO9_A;  5GJS_A;  4XQO_A;  4XQO_C;  4XQO_E;  4XQU_A;  4XQU_C;  4XQU_E;  4LKG_A;  4LKG_C;  4LKG_E;  4ZCJ_A;  4ZCJ_C;  4ZCJ_E;  6II9_A;  6II9_C;  6II9_E;  4GXU_A;  4GXU_C;  4GXU_E;  4GXU_G;  4GXU_I;  4GXU_K;  5W42_A;  5IBL_B;  5IBL_F;  3FKU_A;  3FKU_C;  3FKU_E;  3FKU_G;  3FKU_I;  3FKU_K;  4MHH_A;  4MHH_C;  4MHH_E;  1MQL_A;  1MQL_D;  1MQL_G;  4F3Z_A;  4F3Z_C;  4F3Z_E;  4WSV_A;  4WSV_C;  4WSV_E;  4K63_A;  4K63_C;  4K63_E;  4K63_G;  6II4_A;  6II4_C;  1MQN_A;  1MQN_D;  1MQN_G;  4UBD_A;  4UBD_E;  4UBD_I;  4UBD_M;  4UBD_Q;  4UBD_U;  2FK0_A;  2FK0_C;  2FK0_E;  2FK0_G;  2FK0_I;  2FK0_K;  2FK0_M;  2FK0_O;  2FK0_Q;  5XHV_A;  5XHV_E;  2WRG_H;  2WRG_J;  2WRG_L;  1RD8_A;  1RD8_C;  1RD8_E;  6E7H_A;  6E7H_C;  6E7H_E;  4HG4_A;  4HG4_B;  4HG4_C;  4HG4_D;  4HG4_E;  4HG4_F;  4HG4_G;  4HG4_H;  4HG4_I;  6D8D_A;  6D8D_C;  6D8D_E;  3ZTJ_A;  3ZTJ_C;  3ZTJ_E;  4UO1_A;  4UO1_C;  4UO1_E;  5UG0_A;  4CZ0_A;  4CZ0_C;  4CZ0_E;  5JW3_A;  5WKO_M;  5WKO_N;  5WKO_O;  5WKO_S;  5WKO_T;  5WKO_U;  1KEN_A;  1KEN_C;  1KEN_E;  5Y2M_A;  5Y2M_B;  5Y2M_C;  4NM8_A;  4NM8_C;  4NM8_E;  5JW4_A;  5JW4_C;  5JW4_E;  5JW4_G;  5JW4_I;  5JW4_K;  4UNX_A;  4UNX_C;  4UNX_E;  6B3M_A;  6B3M_E;  6B3M_G;  6B3M_K;  6B3M_Q;  6B3M_S;  5V2A_A;  4O5I_A;  4O5I_C;  4O5I_E;  4O5I_G;  4O5I_I;  4O5I_K;  4FQR_A;  4FQR_C;  4FQR_E;  4FQR_G;  4FQR_I;  4FQR_K;  4FQR_M;  4FQR_O;  4FQR_Q;  4FQR_S;  4FQR_U;  4FQR_W;  4FQV_A;  4FQV_C;  4FQV_E;  4FQY_A;  4MHJ_A;  4MHJ_C;  4MHJ_G;  4MHJ_M;  4MHJ_O;  4MHJ_S;  6MLM_A;  6MLM_B;  6MLM_H;  6HJN_A;  6HJN_C;  6HJN_E;  6HJP_A;  6HJP_C;  6HJP_E;  6HJQ_A;  6HJQ_C;  6HJQ_E;  6HJR_A;  6HJR_C;  6HJR_E;  5UJZ_A;  5UJZ_C;  5UJZ_E;  5UK0_A;  5UK0_C;  5UK0_E;  5UK1_A;  5UK1_C;  5UK1_E;  5UK2_A;  5UK2_C;  5UK2_E; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling