| Link type | Probability | Chain B piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
| view details |
|
Unlink | 74% | -38B +55B | |||||||||
Chain B Sequence |
FRIRKCPKCGRYTLKEVCPVCGEKTKVAHPPRFSPEDPYGEYRRRWKREVLGI |
Chain B Sequence |
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVIIAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAIIEPGKARDLVEEIAMKVKELM |
| sequence length | 53,120 |
| structure length | 53,120 |
| publication title |
Structure of a functional ribonucleoprotein pseudouridine synthase bound to a substrate RNA
pubmed doi rcsb |
| molecule tags | Isomerase/rna |
| molecule keywords | Pseudouridine synthase Cbf5 |
| source organism | Pyrococcus furiosus |
| pdb deposition date | 2009-05-22 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| BC | PF04135 | Nop10p | Nucleolar RNA-binding protein, Nop10p family |
| BC | PF01248 | Ribosomal_L7Ae | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | 60s Ribosomal Protein L30; Chain: A; | 60s Ribosomal Protein L30; Chain: A; |
#chains in the LinkProt database with same CATH superfamily 3HJW ABC; 3HJW BC; #chains in the LinkProt database with same CATH topology 1VH8 CF; 1VH8 AB; 1VH8 CDE; 3HJW BC; 1VH8 ACDE; 1VH8 AC; 1VH8 BCDF; 1VH8 DE; 1VH8 CDEF; 1VH8 BC; 1VH8 ACDF; 1W5F AB; 1VH8 BCF; 1VH8 ACE; 1VH8 ACEF; 1VH8 CEF; 1VH8 ABCF; 1VH8 BCE; 1VH8 BCEF; 3HJW ABC; 1VH8 EF; 1VH8 DEF; 1VH8 ACF; 1VH8 BCDE; 1VH8 CE; 1VH8 ABCE; 1VH8 CDF; 1VH8 DF; 1VH8 ABC; #chains in the LinkProt database with same CATH homology 1VH8 CF; 1VH8 AB; 1VH8 CDE; 3HJW BC; 1VH8 ACDE; 1VH8 AC; 1VH8 BCDF; 1VH8 DE; 1VH8 CDEF; 1VH8 BC; 1VH8 ACDF; 1W5F AB; 1VH8 BCF; 1VH8 ACE; 1VH8 ACEF; 1VH8 CEF; 1VH8 ABCF; 1VH8 BCE; 1VH8 BCEF; 3HJW ABC; 1VH8 EF; 1VH8 DEF; 1VH8 ACF; 1VH8 BCDE; 1VH8 CE; 1VH8 ABCE; 1VH8 CDF; 1VH8 DF; 1VH8 ABC;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
