3FEVBC

Crystal structure of the chimeric muscarinic toxin mt7 with loop 1 from mt1.
Link type Probability Chain B piercings Chain C piercings
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
view details
Unlink Unlink 65% -7B +66B
Interpreting sequences
Chain B Sequence
LTCVTSKSIFGITTENCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK
Chain B Sequence
LTCVTSKSIFGITTENCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK
sequence length 65,65
structure length 65,65
publication title Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Fusion of Muscarinic toxin 1, Muscarinic m1-toxin1
pdb deposition date2008-12-01
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
BC PF00087 Toxin_1Snake toxin
BC PF00087 Toxin_1Snake toxin
BC PF00087 Toxin_1Snake toxin
BC PF00087 Toxin_1Snake toxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3fevB00
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3fevC00
3FEVBC 3FEVABC 3FEVAC
chains in the LinkProt database with same CATH superfamily
3FEVBC 3FEVABC 3FEVAC
chains in the LinkProt database with same CATH topology
3FEVBC 3FEVABC 3FEVAC
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3FEV BC;  3FEV ABC;  3FEV AC; 
#chains in the LinkProt database with same CATH topology
 3FEV BC;  3FEV ABC;  3FEV AC; 
#chains in the LinkProt database with same CATH homology
 3FEV BC;  3FEV ABC;  3FEV AC; 

1V6PA 1V6PB 1VB0A 3NDSA 3NEQA 3NEQB 3EBXA 3FEVA 3FEVC 2VLWA 2VLWB 1QKDA 1QKDB 1QKEA 1ONJA 1FF4A 3HH7A 3HH7B 3ERAA 3ERAB 1FASA 6EBXA 6EBXB 2ERAA 1IQ9A 4DO8A 4DO8B 5MG9A 6PNWA 6PNWB 4IYEA 5EBXA 1FSCA 1QM7A 2H8UA 2H8UB 6F21A 6F21B 6F21C 4EY8B 1KU6B 4BDTB 1F8UB 2X8BB 1B41B 1MAHF 4ZQYA 4ZQYB 4ZQYC 1FSSB 2MJ4A 2LA1A 1VYCA 1MR6A 1JGKA 1JE9A 1G6MA 1TFSA 1DRSA 1CODA 1COEA 1ERAA 1FRAA 1NORA 1NEAA 1NTXA 1NXBA 1V6PA 1V6PB 1VB0A 3NDSA 3NEQA 3NEQB 3EBXA 3FEVA 3FEVB 2VLWA 2VLWB 1QKDA 1QKDB 1QKEA 1ONJA 1FF4A 3HH7A 3HH7B 3ERAA 3ERAB 1FASA 6EBXA 6EBXB 2ERAA 1IQ9A 4DO8A 4DO8B 5MG9A 6PNWA 6PNWB 4IYEA 5EBXA 1FSCA 1QM7A 2H8UA 2H8UB 6F21A 6F21B 6F21C 4EY8B 1KU6B 4BDTB 1F8UB 2X8BB 1B41B 1MAHF 4ZQYA 4ZQYB 4ZQYC 1FSSB 2MJ4A 2LA1A 1VYCA 1MR6A 1JGKA 1JE9A 1G6MA 1TFSA 1DRSA 1CODA 1COEA 1ERAA 1FRAA 1NORA 1NEAA 1NTXA 1NXBA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1V6P_A;  1V6P_B;  1VB0_A;  3NDS_A;  3NEQ_A;  3NEQ_B;  3EBX_A;  3FEV_A;  3FEV_C;  2VLW_A;  2VLW_B;  1QKD_A;  1QKD_B;  1QKE_A;  1ONJ_A;  1FF4_A;  3HH7_A;  3HH7_B;  3ERA_A;  3ERA_B;  1FAS_A;  6EBX_A;  6EBX_B;  2ERA_A;  1IQ9_A;  4DO8_A;  4DO8_B;  5MG9_A;  6PNW_A;  6PNW_B;  4IYE_A;  5EBX_A;  1FSC_A;  1QM7_A;  2H8U_A;  2H8U_B;  6F21_A;  6F21_B;  6F21_C;  4EY8_B;  1KU6_B;  4BDT_B;  1F8U_B;  2X8B_B;  1B41_B;  1MAH_F;  4ZQY_A;  4ZQY_B;  4ZQY_C;  1FSS_B;  2MJ4_A;  2LA1_A;  1VYC_A;  1MR6_A;  1JGK_A;  1JE9_A;  1G6M_A;  1TFS_A;  1DRS_A;  1COD_A;  1COE_A;  1ERA_A;  1FRA_A;  1NOR_A;  1NEA_A;  1NTX_A;  1NXB_A;  1V6P_A;  1V6P_B;  1VB0_A;  3NDS_A;  3NEQ_A;  3NEQ_B;  3EBX_A;  3FEV_A;  3FEV_B;  2VLW_A;  2VLW_B;  1QKD_A;  1QKD_B;  1QKE_A;  1ONJ_A;  1FF4_A;  3HH7_A;  3HH7_B;  3ERA_A;  3ERA_B;  1FAS_A;  6EBX_A;  6EBX_B;  2ERA_A;  1IQ9_A;  4DO8_A;  4DO8_B;  5MG9_A;  6PNW_A;  6PNW_B;  4IYE_A;  5EBX_A;  1FSC_A;  1QM7_A;  2H8U_A;  2H8U_B;  6F21_A;  6F21_B;  6F21_C;  4EY8_B;  1KU6_B;  4BDT_B;  1F8U_B;  2X8B_B;  1B41_B;  1MAH_F;  4ZQY_A;  4ZQY_B;  4ZQY_C;  1FSS_B;  2MJ4_A;  2LA1_A;  1VYC_A;  1MR6_A;  1JGK_A;  1JE9_A;  1G6M_A;  1TFS_A;  1DRS_A;  1COD_A;  1COE_A;  1ERA_A;  1FRA_A;  1NOR_A;  1NEA_A;  1NTX_A;  1NXB_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling