Link type | Probability | Chain A piercings | Chain C piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | Unlink | 78% | |||||||||||
view details | Unlink | 78% | |||||||||||
view details | Unlink | 78% | |||||||||||
view details | Unlink | 78% | |||||||||||
view details | Unlink | 78% | |||||||||||
view details | Unlink | 78% | |||||||||||
view details | Unlink | 78% |
Chain A Sequence |
LTCVTSKSIFGITTENCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK |
Chain A Sequence |
LTCVTSKSIFGITTENCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK |
sequence length | 65,65 |
structure length | 65,65 |
publication title |
Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors.
pubmed doi rcsb |
molecule tags | Toxin |
molecule keywords | Fusion of Muscarinic toxin 1, Muscarinic m1-toxin1 |
pdb deposition date | 2008-12-01 |
LinkProt deposition date | 2016-08-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
AC | PF00087 | Toxin_1 | Snake toxin |
AC | PF00087 | Toxin_1 | Snake toxin |
AC | PF00087 | Toxin_1 | Snake toxin |
AC | PF00087 | Toxin_1 | Snake toxin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Ribbon | CD59 | CD59 | ||
Mainly Beta | Ribbon | CD59 | CD59 |
#chains in the LinkProt database with same CATH superfamily 3FEV BC; 3FEV ABC; 3FEV AC; #chains in the LinkProt database with same CATH topology 3FEV BC; 3FEV ABC; 3FEV AC; #chains in the LinkProt database with same CATH homology 3FEV BC; 3FEV ABC; 3FEV AC;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...