| Link type | Probability | Chain A piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Unlink | 78% | ||||||||||
| view details |
|
Unlink | 78% | ||||||||||
| view details |
|
Unlink | 78% | ||||||||||
| view details |
|
Unlink | 78% | ||||||||||
| view details |
|
Unlink | 78% | ||||||||||
| view details |
|
Unlink | 78% | ||||||||||
| view details |
|
Unlink | 78% | ||||||||||
Chain A Sequence |
LTCVTSKSIFGITTENCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK |
Chain A Sequence |
LTCVTSKSIFGITTENCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK |
| sequence length | 65,65 |
| structure length | 65,65 |
| publication title |
Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors.
pubmed doi rcsb |
| molecule tags | Toxin |
| molecule keywords | Fusion of Muscarinic toxin 1, Muscarinic m1-toxin1 |
| pdb deposition date | 2008-12-01 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AC | PF00087 | Toxin_1 | Snake toxin |
| AC | PF00087 | Toxin_1 | Snake toxin |
| AC | PF00087 | Toxin_1 | Snake toxin |
| AC | PF00087 | Toxin_1 | Snake toxin |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | CD59 | CD59 | ||
| Mainly Beta | Ribbon | CD59 | CD59 |
#chains in the LinkProt database with same CATH superfamily 3FEV BC; 3FEV ABC; 3FEV AC; #chains in the LinkProt database with same CATH topology 3FEV BC; 3FEV ABC; 3FEV AC; #chains in the LinkProt database with same CATH homology 3FEV BC; 3FEV ABC; 3FEV AC;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...