| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Solomon.1 | 64% | -63B -83B | -63A -80A | ||||||||
| view details |
|
Solomon.1 | 64% | -63B -83B | -63A -80A | ||||||||
| view details |
|
Solomon.1 | 64% | -63B -83B | -63A -80A | ||||||||
| view details |
|
Solomon.1 | 64% | -63B -83B | -63A -80A | ||||||||
| view details |
|
Solomon.1 | 64% | -63B -83B | -63A -80A | ||||||||
| view details |
|
Solomon.1 | 64% | -63B -83B | -63A -80A | ||||||||
| view details |
|
Solomon.1 | 64% | -63B -83B | -63A -80A | ||||||||
| view details |
|
Solomon.1 | 64% | -63B -83B | -63A -80A | ||||||||
Chain A Sequence |
NQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIKLTDVLKEGDRIEIYRPLL |
Chain A Sequence |
LNQINIEIAYAFPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIKLTDVLKEGDRIEIYRPLLAD |
| sequence length | 77,80 |
| structure length | 77,80 |
| publication title |
Crystal structure of a 3D domain-swapped dimer of hypothetical protein from Haemophilus influenzae (CASP Target)
rcsb |
| molecule tags | Structural genomics, unknown function |
| molecule keywords | Hypothetical protein |
| source organism | Haemophilus influenzae |
| pdb deposition date | 2006-06-29 |
| LinkProt deposition date | 2016-10-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF03658 | Ub-RnfH | RnfH family Ubiquitin |
| AB | PF03658 | Ub-RnfH | RnfH family Ubiquitin |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Ubiquitin-like (UB roll) | 3d domain-swapped dimer of a hypothetical protein | ||
| Alpha Beta | Roll | Ubiquitin-like (UB roll) | 3d domain-swapped dimer of a hypothetical protein |
#chains in the LinkProt database with same CATH superfamily 2HJ1 AB; #chains in the LinkProt database with same CATH topology 1K50 AC; 1K50 BD; 1Q10 AB; 2G45 AB; 1K50 ACD; 1K50 BC; 1P3Q QRV; 1K50 AD; 1K50 ABCD; 1K50 AB; 1K50 ABD; 2G45 DE; 2G45 BDE; 1K50 CD; 2G45 ABD; 2G45 ADE; 2G45 AE; 1AAR AB; 1P3Q RV; 2HJ1 AB; 1K50 ABC; 2G45 ABE; 1K50 BCD; 1P3Q QV; 2G45 ABDE; 2G45 BD; #chains in the LinkProt database with same CATH homology 2HJ1 AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...