| Link type | Probability | Chain C piercings | Chain E piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Unlink | 85% | ||||||||||
| view details |
|
Unlink | 85% | ||||||||||
| view details |
|
Unlink | 85% | ||||||||||
| view details |
|
Unlink | 85% | ||||||||||
| view details |
|
Unlink | 85% | ||||||||||
| view details |
|
Unlink | 85% | ||||||||||
| view details |
|
Unlink | 85% | ||||||||||
Chain C Sequence |
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFP-------NADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ |
Chain C Sequence |
SLIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHALTDAILGAAALGDIGKLFP-------NADSRGLLREAFRQVQEKGYKIGNVDITIIAQAPKMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ |
| sequence length | 159,159 |
| structure length | 152,152 |
| publication title |
Structural analysis of a set of proteins resulting from a bacterial genomics project
pubmed doi rcsb |
| molecule tags | Lyase |
| molecule keywords | 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase |
| source organism | Haemophilus influenzae |
| missing residues | C: 63-71 E: 63-71 |
| ec nomenclature |
ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. ec 4.6.1.12: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. |
| pdb deposition date | 2003-12-01 |
| LinkProt deposition date | 2016-10-30 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| CE | PF02542 | YgbB | YgbB family |
| CE | PF02542 | YgbB | YgbB family |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | 60s Ribosomal Protein L30; Chain: A; | 60s Ribosomal Protein L30; Chain: A; | ||
| Alpha Beta | 2-Layer Sandwich | 60s Ribosomal Protein L30; Chain: A; | 60s Ribosomal Protein L30; Chain: A; |
#chains in the LinkProt database with same CATH superfamily 1VH8 CF; 1VH8 AB; 1VH8 CDE; 1VH8 ACDE; 1VH8 AC; 1VH8 BCDF; 1VH8 DE; 1VH8 CDEF; 1VH8 BC; 1VH8 ACDF; 1VH8 BCF; 1VH8 ACE; 1VH8 ACEF; 1VH8 CEF; 1VH8 ABCF; 1VH8 BCE; 1VH8 BCEF; 1VH8 EF; 1VH8 DEF; 1VH8 ACF; 1VH8 BCDE; 1VH8 CE; 1VH8 ABCE; 1VH8 CDF; 1VH8 DF; 1VH8 ABC; #chains in the LinkProt database with same CATH topology 1VH8 CF; 1VH8 AB; 1VH8 CDE; 3HJW BC; 1VH8 ACDE; 1VH8 AC; 1VH8 BCDF; 1VH8 DE; 1VH8 CDEF; 1VH8 BC; 1VH8 ACDF; 1W5F AB; 1VH8 BCF; 1VH8 ACE; 1VH8 ACEF; 1VH8 CEF; 1VH8 ABCF; 1VH8 BCE; 1VH8 BCEF; 3HJW ABC; 1VH8 EF; 1VH8 DEF; 1VH8 ACF; 1VH8 BCDE; 1VH8 CE; 1VH8 ABCE; 1VH8 CDF; 1VH8 DF; 1VH8 ABC; #chains in the LinkProt database with same CATH homology 1VH8 CF; 1VH8 AB; 1VH8 CDE; 3HJW BC; 1VH8 ACDE; 1VH8 AC; 1VH8 BCDF; 1VH8 DE; 1VH8 CDEF; 1VH8 BC; 1VH8 ACDF; 1W5F AB; 1VH8 BCF; 1VH8 ACE; 1VH8 ACEF; 1VH8 CEF; 1VH8 ABCF; 1VH8 BCE; 1VH8 BCEF; 3HJW ABC; 1VH8 EF; 1VH8 DEF; 1VH8 ACF; 1VH8 BCDE; 1VH8 CE; 1VH8 ABCE; 1VH8 CDF; 1VH8 DF; 1VH8 ABC;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...