| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
| view details |
|
Unlink | 64% | -7A +57A | |||||||||
Chain A Sequence |
MQYKVILNGKTLKGETTTEAVDAATAEKVVKQFFNDNGVDGEWTYDDATKTFTVTE |
Chain A Sequence |
MQYKVILNGKTLKGETTTEAVDAATAEKVVKQFFNDNGVDGEWTYDDATKTFTVTE |
| sequence length | 56,56 |
| structure length | 56,56 |
| publication title |
A Protein Contortionist: Core Mutations of GB1 that Induce Dimerization and Domain Swapping
pubmed doi rcsb |
| molecule tags | Protein binding |
| molecule keywords | Immunoglobulin G binding protein G |
| source organism | Streptococcus sp. 'group g' |
| pdb deposition date | 2003-07-18 |
| LinkProt deposition date | 2016-10-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF01378 | IgG_binding_B | B domain |
| AB | PF01378 | IgG_binding_B | B domain |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Roll | Ubiquitin-like (UB roll) | Ubiquitin-like (UB roll) | ||
| Alpha Beta | Roll | Ubiquitin-like (UB roll) | Ubiquitin-like (UB roll) |
#chains in the LinkProt database with same CATH superfamily 1K50 CD; 1K50 AC; 1K50 ABC; 1K50 BD; 1K50 BCD; 1K50 ABCD; 1Q10 AB; 1K50 BC; 1K50 ACD; 1K50 AB; 1K50 ABD; 1K50 AD; #chains in the LinkProt database with same CATH topology 1K50 AC; 1K50 BD; 1Q10 AB; 2G45 AB; 1K50 ACD; 1K50 BC; 1P3Q QRV; 1K50 AD; 1K50 ABCD; 1K50 AB; 1K50 ABD; 2G45 DE; 2G45 BDE; 1K50 CD; 2G45 ABD; 2G45 ADE; 2G45 AE; 1AAR AB; 1P3Q RV; 2HJ1 AB; 1K50 ABC; 2G45 ABE; 1K50 BCD; 1P3Q QV; 2G45 ABDE; 2G45 BD; #chains in the LinkProt database with same CATH homology 1K50 CD; 1K50 AC; 1K50 ABC; 1K50 BD; 1K50 BCD; 1K50 ABCD; 1Q10 AB; 1K50 BC; 1K50 ACD; 1K50 AB; 1K50 ABD; 1K50 AD;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...