1P3QQR

Mechanism of ubiquitin recognition by the cue domain of vps9
Warning
  • Temporary problem with connection to RCSB web service - similar chains cannot be displayed.
  • Temporary problem with connection to RCSB web service - similar chains cannot be displayed.
Q: 437-440
Link type Probability Chain Q piercings Chain R piercings
view details
Unlink Unlink 71% +418R -452R
view details
Unlink Unlink 71% +418R -452R
view details
Unlink Unlink 71% +418R -452R
view details
Unlink Unlink 71% +418R -452R
Interpreting sequences
Chain Q Sequence
SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAAAS--GPCVD
Chain Q Sequence
LQNMFPDMDPSLIEDVCIAAASRIGPCVDALLSLSE
sequence length 47,36
structure length 45,36
publication title Mechanism of Ubiquitin Recognition by the CUE Domain of Vps9p.
pubmed doi rcsb
molecule tags Translation
molecule keywords Vacuolar protein sorting-associated protein VPS9
source organism Saccharomyces cerevisiae
missing residues Q: 437-440
pdb deposition date2003-04-18
LinkProt deposition date2016-10-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
QR PF02845 CUECUE domain
QR PF02845 CUECUE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1p3qQ00
1P3QQV 1P3QQR 1P3QQRV
chains in the LinkProt database with same CATH superfamily
3DZDAB 1P3QQR 1P3QQRV 1P3QQV
chains in the LinkProt database with same CATH topology
1P3QQV 1P3QQR 1P3QQRV
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 1P3Q QV;  1P3Q QR;  1P3Q QRV; 
#chains in the LinkProt database with same CATH topology
 3DZD AB;  1P3Q QR;  1P3Q QRV;  1P3Q QV; 
#chains in the LinkProt database with same CATH homology
 1P3Q QV;  1P3Q QR;  1P3Q QRV; 
Warning
  • This is a unique chain - no homologues found.


 
            
               
               
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling