5CROABCO

Refined structure of cro repressor protein from bacteriophage lambda
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain O piercings
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
view details
Other Other 37% +2A +62B -55O
Interpreting sequences
Chain A Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSN
Chain A Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSN
Chain A Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPSN
Chain A Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKPFPS
sequence length 61,61,61,60
structure length 61,61,61,60
publication title Refined structure of Cro repressor protein from bacteriophage lambda suggests both flexibility and plasticity.
pubmed doi rcsb
molecule tags Gene regulating protein
molecule keywords CRO REPRESSOR PROTEIN
pdb deposition date1998-04-17
LinkProt deposition date2016-08-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABCO PF09048 CroCro
ABCO PF09048 CroCro
ABCO PF09048 CroCro
ABCO PF09048 CroCro
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.240.10 Alpha Beta 2-Layer Sandwich CRO Repressor CRO Repressor 5croA00
3.30.240.10 Alpha Beta 2-Layer Sandwich CRO Repressor CRO Repressor 5croB00
3.30.240.10 Alpha Beta 2-Layer Sandwich CRO Repressor CRO Repressor 5croC00
3.30.240.10 Alpha Beta 2-Layer Sandwich CRO Repressor CRO Repressor 5croO00
5CROABCO 5CROCO 5CROBCO 5CROACO 5CROBC 5CROBO 5CROAO 5CROABO 5CROAC 5CROABC 5CROAB
chains in the LinkProt database with same CATH superfamily
5CROABCO 5CROCO 5CROBCO 5CROACO 5CROBC 5CROBO 5CROAO 5CROABO 5CROAC 5CROABC 5CROAB
chains in the LinkProt database with same CATH topology
5CROABCO 5CROCO 5CROBCO 5CROACO 5CROBC 5CROBO 5CROAO 5CROABO 5CROAC 5CROABC 5CROAB
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 5CRO ABCO;  5CRO CO;  5CRO BCO;  5CRO ACO;  5CRO BC;  5CRO BO;  5CRO AO;  5CRO ABO;  5CRO AC;  5CRO ABC;  5CRO AB; 
#chains in the LinkProt database with same CATH topology
 5CRO ABCO;  5CRO CO;  5CRO BCO;  5CRO ACO;  5CRO BC;  5CRO BO;  5CRO AO;  5CRO ABO;  5CRO AC;  5CRO ABC;  5CRO AB; 
#chains in the LinkProt database with same CATH homology
 5CRO ABCO;  5CRO CO;  5CRO BCO;  5CRO ACO;  5CRO BC;  5CRO BO;  5CRO AO;  5CRO ABO;  5CRO AC;  5CRO ABC;  5CRO AB; 

2OVGA 2ECSA 2ECSB 1ORCA 2PIJA 2PIJB 1D1MA 1D1MB 1D1LA 5CROB 5CROC 5CROO 6CROA 5W8ZA 2A63A 3ORCA 2ORCA 1COPD 1COPE 4CROA 4CROB 4CROC 4CROD 4CROE 4CROF 2OVGA 2ECSA 2ECSB 1ORCA 2PIJA 2PIJB 1D1MA 1D1MB 1D1LA 5CROA 5CROC 5CROO 6CROA 5W8ZA 2A63A 3ORCA 2ORCA 1COPD 1COPE 4CROA 4CROB 4CROC 4CROD 4CROE 4CROF 2OVGA 2ECSA 2ECSB 1ORCA 2PIJA 2PIJB 1D1MA 1D1MB 1D1LA 5CROA 5CROB 5CROO 6CROA 5W8ZA 2A63A 3ORCA 2ORCA 1COPD 1COPE 4CROA 4CROB 4CROC 4CROD 4CROE 4CROF 2OVGA 2ECSA 2ECSB 1ORCA 2PIJA 2PIJB 1D1MA 1D1MB 1D1LA 5CROA 5CROB 5CROC 6CROA 5W8ZA 2A63A 3ORCA 2ORCA 1COPD 1COPE 4CROA 4CROB 4CROC 4CROD 4CROE 4CROF
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 2OVG_A;  2ECS_A;  2ECS_B;  1ORC_A;  2PIJ_A;  2PIJ_B;  1D1M_A;  1D1M_B;  1D1L_A;  5CRO_B;  5CRO_C;  5CRO_O;  6CRO_A;  5W8Z_A;  2A63_A;  3ORC_A;  2ORC_A;  1COP_D;  1COP_E;  4CRO_A;  4CRO_B;  4CRO_C;  4CRO_D;  4CRO_E;  4CRO_F;  2OVG_A;  2ECS_A;  2ECS_B;  1ORC_A;  2PIJ_A;  2PIJ_B;  1D1M_A;  1D1M_B;  1D1L_A;  5CRO_A;  5CRO_C;  5CRO_O;  6CRO_A;  5W8Z_A;  2A63_A;  3ORC_A;  2ORC_A;  1COP_D;  1COP_E;  4CRO_A;  4CRO_B;  4CRO_C;  4CRO_D;  4CRO_E;  4CRO_F;  2OVG_A;  2ECS_A;  2ECS_B;  1ORC_A;  2PIJ_A;  2PIJ_B;  1D1M_A;  1D1M_B;  1D1L_A;  5CRO_A;  5CRO_B;  5CRO_O;  6CRO_A;  5W8Z_A;  2A63_A;  3ORC_A;  2ORC_A;  1COP_D;  1COP_E;  4CRO_A;  4CRO_B;  4CRO_C;  4CRO_D;  4CRO_E;  4CRO_F;  2OVG_A;  2ECS_A;  2ECS_B;  1ORC_A;  2PIJ_A;  2PIJ_B;  1D1M_A;  1D1M_B;  1D1L_A;  5CRO_A;  5CRO_B;  5CRO_C;  6CRO_A;  5W8Z_A;  2A63_A;  3ORC_A;  2ORC_A;  1COP_D;  1COP_E;  4CRO_A;  4CRO_B;  4CRO_C;  4CRO_D;  4CRO_E;  4CRO_F; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling