3IYC13

Poliovirus late rna-release intermediate
Link type Probability Chain 1 piercings Chain 3 piercings
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
view details
Hopf.2 Hopf.2 36% -2313 -1011 +1351 -1541 +2451 -2581
Interpreting sequences
Chain 1 Sequence
QHRSRSESSIESFFARGACVTIMTVDNPASTTNKDKLFAVWKITYKDTVQLRRKLEFFTYSRFDMELTFVVTANFTETNNGHALNQVYQIMYVPPGAPVPEKWDDYTWQTSSNPSIFYTYGTAPARISVPYVGISNAYSHFYDGFSKVPLKDQSAALGDSLYGAASLNDFGILAVRVVNDHNPTKVTSKIRVYLKPKHIRVWCPRPPRAVAYYGPGVDYKDGTLTPLSTKDLTTY
Chain 1 Sequence
GLPVMNTPGSNQYLTADNFQSPCALPEFDVTPPIDIPGEVKNMMELAEIDTMIPFDLSATKKNTMEMYRVRLSDKPHTDDPILCLSLSPASDPRLSHTMLGEILNYYTHWAGSLKFTFLFCGSMMATGKLLVSYAPPGADPPKKRKEAMLGTHVIWDIGLQSSCTMVVPWISNTTYRQTIDDSFTEGGYISVFYQTRIVVPLSTPREMDILGFVSACNDFSVRLLRDTTHI
sequence length 235,231
structure length 235,231
publication title Catching a virus in the act of RNA release: a novel poliovirus uncoating intermediate characterized by cryo-electron microscopy.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords Genome polyprotein
source organism Human poliovirus 1 mahoney
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
ec 3.4.22.28: Picornain 3C.
ec 3.4.22.29: Picornain 2A.
ec 3.6.1.15: Nucleoside-triphosphate phosphatase.
pdb deposition date2009-07-21
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
13 PF00073 Rhvpicornavirus capsid protein
13 PF00073 Rhvpicornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)

6ILOA 5KWL1 5KTZ1 5KU01 5KU21 3J2JA 3IYB1 1XYR1 4Q4W3 4Q4X3 4Q4Y3 5C8CC 1AYM3 4WM8C 5BNPC 3VBHC 1PVC3 5BNOC 1FPN3 5OSNC 1ND2C 4WM7C 1HXS3 5BNNC 1NCQC 1D4M3 4RHV3 1EAH3 4Q4V3 1K5MC 1QJU3 3VBFC 2PLV3 4PDWC 4CDQC 3ZFEC 1QJX3 1QJY3 1NCRC 3VBOC 1AYN3 1C8M3 1AR73 1ND3C 1BEV3 4JGYC 1AL23 1PO13 1AR93 4RQPB 4RQPF 4RQPJ 4RQPN 4RQPR 5C4WC 1H8TC 1PO23 1ASJ3 1Z7S3 1OOPC 4CDXC 4RR3B 4RR3F 4RR3J 4RR3N 4RR3R 3VDDC 1NA1C 5C9AC 4CDUC 1VBB3 1POV3 1AR63 1AR83 4N53C 4CDWC 4CEYC 1VBC3 3TN93 3ZFGC 1VBE3 4CEWC 3VBSC 5ABJC 1VBD3 3ZFFC 1RHI3 1VBA3 4JGZC 1MQTC 1RVF3 4GB33 2X5IC 1PIV3 1COV3 1R1A3 1EV13 4N43C 3VBRC 4YVSB 4YVSE 4YVSH 4YVSK 4YVSN 1V9U3 4RS5B 4RS5E 4RS5H 4RS5K 4RS5N 4GMP3 4AEDC 3VBUC 4YVWB 4YVWF 4YVWH 4YVWK 4YVWN 3DPRC 4L3BC 6SK5C 6SK6C 6SK7C 6RJF3 6O06C 6MZIB 6I2KC 6ILLC 6ILMC 6ILNC 6ILOC 6ILPC 6ILJC 6ILKC 6IIOC 6IIJC 6AKSC 6AKTC 6AKUC 6HHTC1 6HHTC2 6HHTF1 6HHTF2 6HHTI1 6HHTI2 6HHTL1 6HHTL2 6HHTO1 6HHTO2 6HHTR1 6HHTR2 6HHTU1 6HHTU2 6HHTX1 6HHTX2 6HHTa2 6HHTd2 6HHTg2 6HHTj2 6HHTm2 6HHTp2 6HHTs2 6HHTv2 6HHTy2 6AJ7C 6AJ9C 6AJ2C 6AJ3C 6AJ0C 6HBGC 6HBHC 6HBJC 6HBKC 6HBKF 6HBKI 6HBKL 6HBKO 6HBKR 6HBKU 6HBKX 6HBKa 6HBKd 6HBKg 6HBLC 6HBLF 6HBLI 6HBLL 6HBLO 6HBLR 6HBLU 6HBLX 6HBLa 6HBLd 6HBLg 6HBLj 6HBLm 6HBLp 6HBLs 6ACYC 6ACZC 6AD0C 6AD1C 6ACUC 6ACWC 6GZVC 6DIZC 6DIJC 6CV1B 6CV2B 6CV3B 6CV4B 6CV5B 6CVBB 6CSAB 6CSGB 6CSHB 6CRPB 6CRRB 6CRSB 6CRUB 6CS3B 6CS4B 6CS5B 6CS6B 5YHQC 6EIT3 5XS4C 5XS5C 5XS7C 5W3LB 5W3MB 5W3OB 5W3EB 5O5P3 5O5B3 5TSLC 5KWL3 5KTZ3 5KU03 5KU23 5K0UB 5JZGB 3JD73 3JBC3 3JBD3 3JBE3 3JBF3 3JBG3 3J9F3 3J913 3J8F3 4C0UC 4C0YC 4C10C 3J483 3J3O3 3J3P3 3J2JB 3J22C 3J23C 3IYPB 3IYB3 3EPC3 3EPD3 3EPF3 2C8IC 1Z7Z3 1UPNC 1NN83 1M113 1JEW3 1DGI3 1D3E3 1D3I3 1VRH3 1RUC3 1RUD3 1RUE3 1RUF3 1RUG3 1RUH3 1RUI3 1RUJ3 1HRV3 2HWB3 2HWC3 2HWD3 2HWE3 2HWF3 1HRI3 1R093 1R083 1RMU3 2R043 2R063 2R073 2RM23 2RMU3 2RR13 2RS13 2RS33 2RS53
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6ILO_A;  5KWL_1;  5KTZ_1;  5KU0_1;  5KU2_1;  3J2J_A;  3IYB_1;  1XYR_1;  4Q4W_3;  4Q4X_3;  4Q4Y_3;  5C8C_C;  1AYM_3;  4WM8_C;  5BNP_C;  3VBH_C;  1PVC_3;  5BNO_C;  1FPN_3;  5OSN_C;  1ND2_C;  4WM7_C;  1HXS_3;  5BNN_C;  1NCQ_C;  1D4M_3;  4RHV_3;  1EAH_3;  4Q4V_3;  1K5M_C;  1QJU_3;  3VBF_C;  2PLV_3;  4PDW_C;  4CDQ_C;  3ZFE_C;  1QJX_3;  1QJY_3;  1NCR_C;  3VBO_C;  1AYN_3;  1C8M_3;  1AR7_3;  1ND3_C;  1BEV_3;  4JGY_C;  1AL2_3;  1PO1_3;  1AR9_3;  4RQP_B;  4RQP_F;  4RQP_J;  4RQP_N;  4RQP_R;  5C4W_C;  1H8T_C;  1PO2_3;  1ASJ_3;  1Z7S_3;  1OOP_C;  4CDX_C;  4RR3_B;  4RR3_F;  4RR3_J;  4RR3_N;  4RR3_R;  3VDD_C;  1NA1_C;  5C9A_C;  4CDU_C;  1VBB_3;  1POV_3;  1AR6_3;  1AR8_3;  4N53_C;  4CDW_C;  4CEY_C;  1VBC_3;  3TN9_3;  3ZFG_C;  1VBE_3;  4CEW_C;  3VBS_C;  5ABJ_C;  1VBD_3;  3ZFF_C;  1RHI_3;  1VBA_3;  4JGZ_C;  1MQT_C;  1RVF_3;  4GB3_3;  2X5I_C;  1PIV_3;  1COV_3;  1R1A_3;  1EV1_3;  4N43_C;  3VBR_C;  4YVS_B;  4YVS_E;  4YVS_H;  4YVS_K;  4YVS_N;  1V9U_3;  4RS5_B;  4RS5_E;  4RS5_H;  4RS5_K;  4RS5_N;  4GMP_3;  4AED_C;  3VBU_C;  4YVW_B;  4YVW_F;  4YVW_H;  4YVW_K;  4YVW_N;  3DPR_C;  4L3B_C;  6SK5_C;  6SK6_C;  6SK7_C;  6RJF_3;  6O06_C;  6MZI_B;  6I2K_C;  6ILL_C;  6ILM_C;  6ILN_C;  6ILO_C;  6ILP_C;  6ILJ_C;  6ILK_C;  6IIO_C;  6IIJ_C;  6AKS_C;  6AKT_C;  6AKU_C;  6HHT_C1;  6HHT_C2;  6HHT_F1;  6HHT_F2;  6HHT_I1;  6HHT_I2;  6HHT_L1;  6HHT_L2;  6HHT_O1;  6HHT_O2;  6HHT_R1;  6HHT_R2;  6HHT_U1;  6HHT_U2;  6HHT_X1;  6HHT_X2;  6HHT_a2;  6HHT_d2;  6HHT_g2;  6HHT_j2;  6HHT_m2;  6HHT_p2;  6HHT_s2;  6HHT_v2;  6HHT_y2;  6AJ7_C;  6AJ9_C;  6AJ2_C;  6AJ3_C;  6AJ0_C;  6HBG_C;  6HBH_C;  6HBJ_C;  6HBK_C;  6HBK_F;  6HBK_I;  6HBK_L;  6HBK_O;  6HBK_R;  6HBK_U;  6HBK_X;  6HBK_a;  6HBK_d;  6HBK_g;  6HBL_C;  6HBL_F;  6HBL_I;  6HBL_L;  6HBL_O;  6HBL_R;  6HBL_U;  6HBL_X;  6HBL_a;  6HBL_d;  6HBL_g;  6HBL_j;  6HBL_m;  6HBL_p;  6HBL_s;  6ACY_C;  6ACZ_C;  6AD0_C;  6AD1_C;  6ACU_C;  6ACW_C;  6GZV_C;  6DIZ_C;  6DIJ_C;  6CV1_B;  6CV2_B;  6CV3_B;  6CV4_B;  6CV5_B;  6CVB_B;  6CSA_B;  6CSG_B;  6CSH_B;  6CRP_B;  6CRR_B;  6CRS_B;  6CRU_B;  6CS3_B;  6CS4_B;  6CS5_B;  6CS6_B;  5YHQ_C;  6EIT_3;  5XS4_C;  5XS5_C;  5XS7_C;  5W3L_B;  5W3M_B;  5W3O_B;  5W3E_B;  5O5P_3;  5O5B_3;  5TSL_C;  5KWL_3;  5KTZ_3;  5KU0_3;  5KU2_3;  5K0U_B;  5JZG_B;  3JD7_3;  3JBC_3;  3JBD_3;  3JBE_3;  3JBF_3;  3JBG_3;  3J9F_3;  3J91_3;  3J8F_3;  4C0U_C;  4C0Y_C;  4C10_C;  3J48_3;  3J3O_3;  3J3P_3;  3J2J_B;  3J22_C;  3J23_C;  3IYP_B;  3IYB_3;  3EPC_3;  3EPD_3;  3EPF_3;  2C8I_C;  1Z7Z_3;  1UPN_C;  1NN8_3;  1M11_3;  1JEW_3;  1DGI_3;  1D3E_3;  1D3I_3;  1VRH_3;  1RUC_3;  1RUD_3;  1RUE_3;  1RUF_3;  1RUG_3;  1RUH_3;  1RUI_3;  1RUJ_3;  1HRV_3;  2HWB_3;  2HWC_3;  2HWD_3;  2HWE_3;  2HWF_3;  1HRI_3;  1R09_3;  1R08_3;  1RMU_3;  2R04_3;  2R06_3;  2R07_3;  2RM2_3;  2RMU_3;  2RR1_3;  2RS1_3;  2RS3_3;  2RS5_3; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling