3IV1ABC

Coiled-coil domain of tumor susceptibility gene 101
Link type Probability Chain A piercings Chain B piercings Chain C piercings
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
view details
Hopf.1 U Ring Hopf.1 U Ring 33% +267B +304C +262C -304C -277B +304B
Interpreting sequences
Chain A Sequence
GSSLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEK
Chain A Sequence
GSSLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEK
Chain A Sequence
GSSLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEK
sequence length 78,78,78
structure length 78,78,78
publication title Coiled-Coil Domain of Human Tsg101
rcsb
molecule tags Hydrolase
molecule keywords Tumor susceptibility gene 101 protein
source organism Homo sapiens
pdb deposition date2009-08-31
LinkProt deposition date2016-08-17
Image from the rcsb pdb (www.rcsb.org)

3IV1B 3IV1C 3IV1D 3IV1E 3IV1F 3IV1G 3IV1H 3IV1A 3IV1C 3IV1D 3IV1E 3IV1F 3IV1G 3IV1H 3IV1A 3IV1B 3IV1D 3IV1E 3IV1F 3IV1G 3IV1H
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3IV1_B;  3IV1_C;  3IV1_D;  3IV1_E;  3IV1_F;  3IV1_G;  3IV1_H;  3IV1_A;  3IV1_C;  3IV1_D;  3IV1_E;  3IV1_F;  3IV1_G;  3IV1_H;  3IV1_A;  3IV1_B;  3IV1_D;  3IV1_E;  3IV1_F;  3IV1_G;  3IV1_H; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling