3H90BD

Structural basis for the autoregulation of the zinc transporter yiip
Link type Probability Chain B piercings Chain D piercings
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
view details
Unlink Unlink 61% -276B +291B
Interpreting sequences
Chain B Sequence
LVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSGPTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVV
Chain B Sequence
LVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVVRYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIVTIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSWYGWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSGPTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVV
sequence length 283,283
structure length 283,283
publication title Structural basis for autoregulation of the zinc transporter YiiP.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Ferrous-iron efflux pump fieF
source organism Escherichia coli k-12
pdb deposition date2009-04-29
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
BD PF01545 Cation_effluxCation efflux family
BD PF16916 ZT_dimerDimerisation domain of Zinc Transporter
BD PF01545 Cation_effluxCation efflux family
BD PF16916 ZT_dimerDimerisation domain of Zinc Transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1510.10 Mainly Alpha Up-down Bundle Alpha-lytic protease prodomain-like Cation efflux protein cytoplasmic domain-like 3h90B01
3.30.70.1350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cation efflux protein cytoplasmic domain-like 3h90B02
1.20.1510.10 Mainly Alpha Up-down Bundle Alpha-lytic protease prodomain-like Cation efflux protein cytoplasmic domain-like 3h90D01
3.30.70.1350 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Cation efflux protein cytoplasmic domain-like 3h90D02
3H90BCD 3H90AD 3H90ABD 3H90ACD 3H90AB 3H90BC 3H90BD 3H90ABC 3H90AC
chains in the LinkProt database with same CATH superfamily
3H90AD 3GYXBDE 3H90BC 3GYXACH 3GYXCIJ 3GYXJL 3GYXABK 3GYXDIJ 3GYXDEL 3GYXFK 3GYXBEK 2A6MAB 3GYXADK 3GYXBCD 3GYXAJK 3GYXHJK 3GYXHKL 3GYXCFJ 3GYXBCI 3GYXAHI 3GYXABD 3GYXCEJ 3GYXFIJ 3GYXEGH 3GYXBD 3GYXHIK 3GYXCGH 3GYXAEF 3GYXJK 3GYXCDG 3GYXCIL 3GYXADF 3GYXBCG 3GYXCJL 3GYXCFI 3GYXCF 3GYXAHL 3GYXABG 3GYXBH 3GYXGIL 3GYXGL 3GYXAGL 3GYXEFG 3GYXCJK 3GYXBDI 3GYXHI 3GYXADE 3GYXBHK 3GYXABF 3GYXEF 3GYXCKL 3GYXFKL 3GYXKL 3GYXDGH 3GYXHJ 3GYXCDH 3GYXBG 3GYXEFJ 3GYXBEG 3H90AC 3GYXBHI 3GYXEIJ 3GYXDF 3GYXGHK 3GYXABJ 3GYXJKL 3GYXBGL 3GYXEJK 3GYXDEK 3GYXCDK 3GYXGKL 3GYXBEJ 3GYXADJ 3GYXAKL 3GYXBDG 3GYXCGJ 3FDSACD 3GYXAEH 3GYXDI 3GYXHIJ 3GYXHL 3GYXIJL 3GYXCDF 3GYXBEI 3GYXCFG 3GYXBIJ 3GYXADI 3GYXBCF 3GYXCFH 3GYXACD 3GYXGHL 3GYXIJ 3H90BCD 3GYXCEH 3GYXEJL 3H90ACD 3GYXBF 3GYXCDL 3GYXEHK 3GYXBFG 3GYXAFG 3GYXBEL 3H90BD 3GYXAB 3GYXACJ 3GYXCD 3GYXGIJ 3GYXBGH 3GYXABC 3GYXDEG 3GYXAGJ 3GYXEFI 3GYXBEF 3H90AB 3GYXACF 3GYXFGH 3GYXFJK 2ZEJAB 3EGWBC 3GYXAIJ 3EGWAB 3GYXGHJ 3GYXABI 3GYXDJ 3GYXIKL 3GYXBGK 3GYXDHI 3GYXGJL 3GYXCDJ 3GYXEFL 3H90ABD 3GYXBGI 3H90ABC 3GYXFGK 3GYXCFL 3GYXEIL 3GYXEKL 3FDSAC 3GYXCEL 3GYXABL 3GYXDIK 3GYXGJK 3GYXIJK 3GYXCDE 3GYXFL 3GYXBEH 3GYXADH 3GYXBCE 3GYXAFH 3GYXCFK 3GYXBJK 3GYXFIK 3GYXBE 3GYXHIL 3GYXAHK 3GYXEL 3GYXGH 3GYXFGL 3GYXADG 3GYXAFK 3GYXAD 3GYXDKL 3GYXDIL 3GYXCEF 3GYXEGL 3GYXBKL 3GYXDEF 3GYXCHI 3GYXCGL 3GYXEFH 3GYXACL 3GYXCJ 3GYXGHI 3GYXABH 3GYXEHI 3GYXBGJ 3GYXABE 3GYXDGI 3GYXDEI 3GYXAGH 3EGWABC 3GYXCDI 3GYXEFK
chains in the LinkProt database with same CATH topology
3H90BCD 3H90AD 3H90ABD 3H90ACD 3H90AB 3H90BC 3H90BD 3H90ABC 3H90AC
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3H90 BCD;  3H90 AD;  3H90 ABD;  3H90 ACD;  3H90 AB;  3H90 BC;  3H90 BD;  3H90 ABC;  3H90 AC; 
#chains in the LinkProt database with same CATH topology
 3H90 AD;  3GYX BDE;  3H90 BC;  3GYX ACH;  3GYX CIJ;  3GYX JL;  3GYX ABK;  3GYX DIJ;  3GYX DEL;  3GYX FK;  3GYX BEK;  2A6M AB;  3GYX ADK;  3GYX BCD;  3GYX AJK;  3GYX HJK;  3GYX HKL;  3GYX CFJ;  3GYX BCI;  3GYX AHI;  3GYX ABD;  3GYX CEJ;  3GYX FIJ;  3GYX EGH;  3GYX BD;  3GYX HIK;  3GYX CGH;  3GYX AEF;  3GYX JK;  3GYX CDG;  3GYX CIL;  3GYX ADF;  3GYX BCG;  3GYX CJL;  3GYX CFI;  3GYX CF;  3GYX AHL;  3GYX ABG;  3GYX BH;  3GYX GIL;  3GYX GL;  3GYX AGL;  3GYX EFG;  3GYX CJK;  3GYX BDI;  3GYX HI;  3GYX ADE;  3GYX BHK;  3GYX ABF;  3GYX EF;  3GYX CKL;  3GYX FKL;  3GYX KL;  3GYX DGH;  3GYX HJ;  3GYX CDH;  3GYX BG;  3GYX EFJ;  3GYX BEG;  3H90 AC;  3GYX BHI;  3GYX EIJ;  3GYX DF;  3GYX GHK;  3GYX ABJ;  3GYX JKL;  3GYX BGL;  3GYX EJK;  3GYX DEK;  3GYX CDK;  3GYX GKL;  3GYX BEJ;  3GYX ADJ;  3GYX AKL;  3GYX BDG;  3GYX CGJ;  3FDS ACD;  3GYX AEH;  3GYX DI;  3GYX HIJ;  3GYX HL;  3GYX IJL;  3GYX CDF;  3GYX BEI;  3GYX CFG;  3GYX BIJ;  3GYX ADI;  3GYX BCF;  3GYX CFH;  3GYX ACD;  3GYX GHL;  3GYX IJ;  3H90 BCD;  3GYX CEH;  3GYX EJL;  3H90 ACD;  3GYX BF;  3GYX CDL;  3GYX EHK;  3GYX BFG;  3GYX AFG;  3GYX BEL;  3H90 BD;  3GYX AB;  3GYX ACJ;  3GYX CD;  3GYX GIJ;  3GYX BGH;  3GYX ABC;  3GYX DEG;  3GYX AGJ;  3GYX EFI;  3GYX BEF;  3H90 AB;  3GYX ACF;  3GYX FGH;  3GYX FJK;  2ZEJ AB;  3EGW BC;  3GYX AIJ;  3EGW AB;  3GYX GHJ;  3GYX ABI;  3GYX DJ;  3GYX IKL;  3GYX BGK;  3GYX DHI;  3GYX GJL;  3GYX CDJ;  3GYX EFL;  3H90 ABD;  3GYX BGI;  3H90 ABC;  3GYX FGK;  3GYX CFL;  3GYX EIL;  3GYX EKL;  3FDS AC;  3GYX CEL;  3GYX ABL;  3GYX DIK;  3GYX GJK;  3GYX IJK;  3GYX CDE;  3GYX FL;  3GYX BEH;  3GYX ADH;  3GYX BCE;  3GYX AFH;  3GYX CFK;  3GYX BJK;  3GYX FIK;  3GYX BE;  3GYX HIL;  3GYX AHK;  3GYX EL;  3GYX GH;  3GYX FGL;  3GYX ADG;  3GYX AFK;  3GYX AD;  3GYX DKL;  3GYX DIL;  3GYX CEF;  3GYX EGL;  3GYX BKL;  3GYX DEF;  3GYX CHI;  3GYX CGL;  3GYX EFH;  3GYX ACL;  3GYX CJ;  3GYX GHI;  3GYX ABH;  3GYX EHI;  3GYX BGJ;  3GYX ABE;  3GYX DGI;  3GYX DEI;  3GYX AGH;  3EGW ABC;  3GYX CDI;  3GYX EFK; 
#chains in the LinkProt database with same CATH homology
 3H90 BCD;  3H90 AD;  3H90 ABD;  3H90 ACD;  3H90 AB;  3H90 BC;  3H90 BD;  3H90 ABC;  3H90 AC; 

3H90A 3H90C 3H90D 2QFIA 2QFIB 5VRFA 5VRFB 3J1ZP 3J1ZQ 3H90A 3H90B 3H90C 2QFIA 2QFIB 5VRFA 5VRFB 3J1ZP 3J1ZQ
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3H90_A;  3H90_C;  3H90_D;  2QFI_A;  2QFI_B;  5VRF_A;  5VRF_B;  3J1Z_P;  3J1Z_Q;  3H90_A;  3H90_B;  3H90_C;  2QFI_A;  2QFI_B;  5VRF_A;  5VRF_B;  3J1Z_P;  3J1Z_Q; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling