3GQHAC

Crystal structure of the bacteriophage phi29 gene product 12 c-terminal fragment
Link type Probability Chain A piercings Chain C piercings
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
view details
Unlink Unlink 51% +692C -735C -800C +855C +724A -855A
Interpreting sequences
Chain A Sequence
DFAEYFESLGGQVIETGYLVTLEKGKIRKAEKGEKIIGVISETAGFVLGESSFEWQGAVLKNEFGGIIYEEVTTEDGVKFKRPLPNPDFDPNKNYIPRSQRREWHVVGLLGQIAVRIDETVKQGHSIDAVGGVATDGDNFIVQEITTPYTKEKGYGVAIVLVK
Chain A Sequence
DFAEYFESLGGQVIETGYLVTLEKGKIRKAEKGEKIIGVISETAGFVLGESSFEWQGAVLKNEFGGIIYEEVTTEDGVKFKRPLPNPDFDPNKNYIPRSQRREWHVVGLLGQIAVRIDETVKQGHSIDAVGGVATDGDNFIVQEITTPYTKEKGYGVAIVLVK
sequence length 163,163
structure length 163,163
publication title Crystallographic insights into the autocatalytic assembly mechanism of a bacteriophage tail spike.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords Preneck appendage protein
source organism Bacillus phage phi29
pdb deposition date2009-03-24
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AC PF11962 Peptidase_G2Peptidase_G2, IMC autoproteolytic cleavage domain
AC PF11962 Peptidase_G2Peptidase_G2, IMC autoproteolytic cleavage domain
Image from the rcsb pdb (www.rcsb.org)

3GQHB 3GQHC 3GQKA 3GQHA 3GQHB 3GQKA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3GQH_B;  3GQH_C;  3GQK_A;  3GQH_A;  3GQH_B;  3GQK_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling