3EO8AEF

Crystal structure of blub-like flavoprotein (yp_001089088.1) from clostridium difficile 630 at 1.74 a resolution
Link type Probability Chain A piercings Chain E piercings Chain F piercings
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
view details
Unlink Unlink 32% -3A +15A -37A +142A -160A -37E +48E -105E +140E -166E +190E -213E
Interpreting sequences
Chain A Sequence
GMELQDTIFKRQSVRKFKNQDVSDEDILKMIKAAGAAPSGKNIQNWHFVVIKRRDLMEKIADVITKKQQEILVEMDKVSVDKANRFRKFVKNFTLFYLKAPVLVLVFTKVYNPSGYYELELIDAPKETIDKLFIRNPGMQSLGAAIENFTLSAIELGYGSCWLTSQNYAADEIEAVLEAETGFEKGEYFLGAMLALGVPEDNLKSPSKKPVEEICTFIK
Chain A Sequence
GMELQDTIFKRQSVRKFKNQDVSDEDILKMIKAAGAAPSGKNIQNWHFVVIKRRDLMEKIADVITKKQQEILVEMDKVSVDKANRFRKFVKNFTLFYLKAPVLVLVFTKVYNPSGYYELELIDAPKETIDKLFIRNPGMQSLGAAIENFTLSAIELGYGSCWLTSQNYAADEIEAVLEAETGFEKGEYFLGAMLALGVPEDNLKSPSKKPVEEICTFIK
Chain A Sequence
GMELQDTIFKRQSVRKFKNQDVSDEDILKMIKAAGAAPSGKNIQNWHFVVIKRRDLMEKIADVITKKQQEILVEMDKVSVDKANRFRKFVKNFTLFYLKAPVLVLVFTKVYNPSGYYELELIDAPKETIDKLFIRNPGMQSLGAAIENFTLSAIELGYGSCWLTSQNYAADEIEAVLEAETGFEKGEYFLGAMLALGVPEDNLKSPSKKPVEEICTFIK
sequence length 219,219,219
structure length 219,219,219
publication title Crystal structure of BluB-like flavoprotein (YP_001089088.1) from CLOSTRIDIUM DIFFICILE 630 at 1.74 A resolution
rcsb
molecule tags Flavoprotein
molecule keywords BluB-like flavoprotein
source organism Clostridium difficile 630
pdb deposition date2008-09-26
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AEF PF00881 NitroreductaseNitroreductase family
AEF PF00881 NitroreductaseNitroreductase family
AEF PF00881 NitroreductaseNitroreductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.109.10 Alpha Beta 3-Layer(aba) Sandwich NADH Oxidase NADH Oxidase 3eo8A00
3.40.109.10 Alpha Beta 3-Layer(aba) Sandwich NADH Oxidase NADH Oxidase 3eo8E00
3.40.109.10 Alpha Beta 3-Layer(aba) Sandwich NADH Oxidase NADH Oxidase 3eo8F00
3EO8CEF 3EO8BEF 3EO8AEF 3EO8CDF 3EO8CF 3EO8CDE 3EO8BDF 3EO8ABD 3EO8ABC 3EO8ABE 3EO8ADF 3EO8ACF 3EO8ABF 3EO8CD 3EO8ACD 3EO8BCD 3EO8DEF 3EO8BF 3EO8BCF 3EO8AB 3EO8EF
chains in the LinkProt database with same CATH superfamily
3EO8CEF 3EO8BEF 3EO8AEF 3EO8CDF 3EO8CF 3EO8CDE 3EO8BDF 3EO8ABD 3EO8ABC 3EO8ABE 3EO8ADF 3EO8ACF 3EO8ABF 3EO8CD 3EO8ACD 3EO8BCD 3EO8DEF 3EO8BF 3EO8BCF 3EO8AB 3EO8EF
chains in the LinkProt database with same CATH topology
3EO8CEF 3EO8BEF 3EO8AEF 3EO8CDF 3EO8CF 3EO8CDE 3EO8BDF 3EO8ABD 3EO8ABC 3EO8ABE 3EO8ADF 3EO8ACF 3EO8ABF 3EO8CD 3EO8ACD 3EO8BCD 3EO8DEF 3EO8BF 3EO8BCF 3EO8AB 3EO8EF
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3EO8 CEF;  3EO8 BEF;  3EO8 AEF;  3EO8 CDF;  3EO8 CF;  3EO8 CDE;  3EO8 BDF;  3EO8 ABD;  3EO8 ABC;  3EO8 ABE;  3EO8 ADF;  3EO8 ACF;  3EO8 ABF;  3EO8 CD;  3EO8 ACD;  3EO8 BCD;  3EO8 DEF;  3EO8 BF;  3EO8 BCF;  3EO8 AB;  3EO8 EF; 
#chains in the LinkProt database with same CATH topology
 3EO8 CEF;  3EO8 BEF;  3EO8 AEF;  3EO8 CDF;  3EO8 CF;  3EO8 CDE;  3EO8 BDF;  3EO8 ABD;  3EO8 ABC;  3EO8 ABE;  3EO8 ADF;  3EO8 ACF;  3EO8 ABF;  3EO8 CD;  3EO8 ACD;  3EO8 BCD;  3EO8 DEF;  3EO8 BF;  3EO8 BCF;  3EO8 AB;  3EO8 EF; 
#chains in the LinkProt database with same CATH homology
 3EO8 CEF;  3EO8 BEF;  3EO8 AEF;  3EO8 CDF;  3EO8 CF;  3EO8 CDE;  3EO8 BDF;  3EO8 ABD;  3EO8 ABC;  3EO8 ABE;  3EO8 ADF;  3EO8 ACF;  3EO8 ABF;  3EO8 CD;  3EO8 ACD;  3EO8 BCD;  3EO8 DEF;  3EO8 BF;  3EO8 BCF;  3EO8 AB;  3EO8 EF; 

3EO8B 3EO8C 3EO8D 3EO8E 3EO8F 3EO8A 3EO8B 3EO8C 3EO8D 3EO8F 3EO8A 3EO8B 3EO8C 3EO8D 3EO8E
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3EO8_B;  3EO8_C;  3EO8_D;  3EO8_E;  3EO8_F;  3EO8_A;  3EO8_B;  3EO8_C;  3EO8_D;  3EO8_F;  3EO8_A;  3EO8_B;  3EO8_C;  3EO8_D;  3EO8_E; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling