| Link type | Probability | Chain A piercings | Chain C piercings | Chain D piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
| view details |
|
Other | 19% | +68A +219D | +26A -36A -219A -37C +48C -104C +141C -165C +190C -213C | |||||||||
Chain A Sequence |
GMELQDTIFKRQSVRKFKNQDVSDEDILKMIKAAGAAPSGKNIQNWHFVVIKRRDLMEKIADVITKKQQEILVEMDKVSVDKANRFRKFVKNFTLFYLKAPVLVLVFTKVYNPSGYYELELIDAPKETIDKLFIRNPGMQSLGAAIENFTLSAIELGYGSCWLTSQNYAADEIEAVLEAETGFEKGEYFLGAMLALGVPEDNLKSPSKKPVEEICTFIK |
Chain A Sequence |
GMELQDTIFKRQSVRKFKNQDVSDEDILKMIKAAGAAPSGKNIQNWHFVVIKRRDLMEKIADVITKKQQEILVEMDKVSVDKANRFRKFVKNFTLFYLKAPVLVLVFTKVYNPSGYYELELIDAPKETIDKLFIRNPGMQSLGAAIENFTLSAIELGYGSCWLTSQNYAADEIEAVLEAETGFEKGEYFLGAMLALGVPEDNLKSPSKKPVEEICTFIK |
Chain A Sequence |
GMELQDTIFKRQSVRKFKNQDVSDEDILKMIKAAGAAPSGKNIQNWHFVVIKRRDLMEKIADVITKKQQEILVEMDKVSVDKANRFRKFVKNFTLFYLKAPVLVLVFTKVYNPSGYYELELIDAPKETIDKLFIRNPGMQSLGAAIENFTLSAIELGYGSCWLTSQNYAADEIEAVLEAETGFEKGEYFLGAMLALGVPEDNLKSPSKKPVEEICTFIK |
| sequence length | 219,219,219 |
| structure length | 219,219,219 |
| publication title |
Crystal structure of BluB-like flavoprotein (YP_001089088.1) from CLOSTRIDIUM DIFFICILE 630 at 1.74 A resolution
rcsb |
| molecule tags | Flavoprotein |
| molecule keywords | BluB-like flavoprotein |
| source organism | Clostridium difficile 630 |
| pdb deposition date | 2008-09-26 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| ACD | PF00881 | Nitroreductase | Nitroreductase family |
| ACD | PF00881 | Nitroreductase | Nitroreductase family |
| ACD | PF00881 | Nitroreductase | Nitroreductase family |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | NADH Oxidase | NADH Oxidase | ||
| Alpha Beta | 3-Layer(aba) Sandwich | NADH Oxidase | NADH Oxidase | ||
| Alpha Beta | 3-Layer(aba) Sandwich | NADH Oxidase | NADH Oxidase |
#chains in the LinkProt database with same CATH superfamily 3EO8 CEF; 3EO8 BEF; 3EO8 AEF; 3EO8 CDF; 3EO8 CF; 3EO8 CDE; 3EO8 BDF; 3EO8 ABD; 3EO8 ABC; 3EO8 ABE; 3EO8 ADF; 3EO8 ACF; 3EO8 ABF; 3EO8 CD; 3EO8 ACD; 3EO8 BCD; 3EO8 DEF; 3EO8 BF; 3EO8 BCF; 3EO8 AB; 3EO8 EF; #chains in the LinkProt database with same CATH topology 3EO8 CEF; 3EO8 BEF; 3EO8 AEF; 3EO8 CDF; 3EO8 CF; 3EO8 CDE; 3EO8 BDF; 3EO8 ABD; 3EO8 ABC; 3EO8 ABE; 3EO8 ADF; 3EO8 ACF; 3EO8 ABF; 3EO8 CD; 3EO8 ACD; 3EO8 BCD; 3EO8 DEF; 3EO8 BF; 3EO8 BCF; 3EO8 AB; 3EO8 EF; #chains in the LinkProt database with same CATH homology 3EO8 CEF; 3EO8 BEF; 3EO8 AEF; 3EO8 CDF; 3EO8 CF; 3EO8 CDE; 3EO8 BDF; 3EO8 ABD; 3EO8 ABC; 3EO8 ABE; 3EO8 ADF; 3EO8 ACF; 3EO8 ABF; 3EO8 CD; 3EO8 ACD; 3EO8 BCD; 3EO8 DEF; 3EO8 BF; 3EO8 BCF; 3EO8 AB; 3EO8 EF;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...