3EGWAC

The crystal structure of the narghi mutant narh - c16a
Link type Probability Chain A piercings Chain C piercings
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
view details
Unlink Unlink 40% +1108A -1230A
Interpreting sequences
Chain A Sequence
SKFLDRFRYAKQKGETFADGHGQLLNTNRDWEDGYRQRWQHDKIVRSTHGVNCTGSCSWKIYVKNGLVTWETQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLKYPMMRKRLMKMWREAKALHSDPVEAWASIIEDADKAKSFKQARGRGGFVRSSWQEVNELIAASNVYTIKNYGPDRVAGFSPIPAMSMVSYASGARYLSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPESADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTVAVTPDYAEIAKLCDLWLAPKQGTDAAMALAMGHVMLREFHLDNPSQYFTDYVRRYTDMPMLVMLEERDGYYAAGRMLRAADLVAALGQENNPEWKTVAFNTNGEMVAPNGSIGFRWGEKGKWNLEQRDGKTGEETELQLSLLGSQDEIAEVGFPYFGGDGTEHFNKVELENVLLHKLPVKRLQLADGSTALVTTVYDLTLANYGLERGLNDVNCATSYDDVKAYTPAWAEQITGVSRSQIIRIAREFADNADKTHGRSMIIVGAGLNHWYHLDMNYRGLINMLIFCGCVGQSGGGWAHYVGQEKLRPQTGWQPLAFALDWQRPARHMNSTSYFYNHSSQWRYETVTAEELLSPMADKSRYTGHLIDFNVRAERMGWLPSAPQLGTNPLTIAGEAEKAGMNPVDYTVKSLKEGSIRFAAEQPENGKNHPRNLFIWRSNLLGSSGKGHEFMLKYLLGTEHGIQGKDLGQQGGVKPEEVDWQDNGLEGKLDLVVTLDFRLSSTCLYSDIILPTATWYEKDDMNTSDMHPFIHPLSAAVDPAWEAKSDWEIYKAIAKKFSEVCVGHLGKETDIVTLPIQHDSAAELAQPLDVKDWKKGECDLIPGKTAPHIMVVERDYPATYERFTSIGPLMEKIGNGGKGIAWNTQSEMDLLRKLNYTKAEGPAKGQPMLNTAIDAAEMILTLAPETNGQVAVKAWAALSEFTGRDHTHLALNKEDEKIRFRDIQAQPRKIISSPTWSGLEDEHVSYNAGYTNVHELIPWRTLSGRQQLYQDHQWMRDFGESLLVYRPPIDTRSVKEVIGQKSNGNQEKALNFLTPHQKWGIHSTYSDNLLMLTLGRGGPVVWLSEADAKDLGIADNDWIEVFNSNGALTARAVVSQRVPAGMTMMYHAQERIVNLPGSEITQQRGGIHNSVTRITPKPTHMIGGYAHLAYGFNYYGTVGSNRDEFVVVRKMKNIDWLDGEGNDQVQES
Chain A Sequence
MQFLNMFFFDIYPYIAGAVFLIGSWLRYDYGQYTWRAASSQMLDRKGMNLASNLFHIGILGIFVGHFFGMLTPHWMAAAWLPIEVKQKMAMFAGGASGVLCLIGGVLLLKRRLFSPRVRATTTGADILILSLLVIQCALGLLTIPFSAQHMDGSEMMKLVGWAQSVVTFHGGASQHLDGVAFIFRLHLVLGMTLFLLFPFSRLIHIWSVPVEYLTRKYQLVRARH
sequence length 1244,225
structure length 1244,225
publication title When width is more important than height: Barriers to electron transfer in E.coli nitrate reductase
rcsb
molecule tags Oxidoreductase
molecule keywords Respiratory nitrate reductase 1 alpha chain
source organism Escherichia coli
ec nomenclature ec 1.7.99.4: Nitrate reductase.
ec 1.7.99.4: Nitrate reductase.
pdb deposition date2008-09-11
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AC PF00384 MolybdopterinMolybdopterin oxidoreductase
AC PF01568 Molydop_bindingMolydopterin dinucleotide binding domain
AC PF14710 Nitr_red_alph_NRespiratory nitrate reductase alpha N-terminal
AC PF02665 Nitrate_red_gamNitrate reductase gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.950.20 Mainly Alpha Up-down Bundle Fumarate Reductase Cytochrome B subunit Transmembrane di-heme cytochromes, Chain C 3egwC01
3EGWBC 3EGWABC 3EGWAC
chains in the LinkProt database with same CATH superfamily
3EGWBC 3EGWABC 3EGWAC
chains in the LinkProt database with same CATH topology
3EGWBC 3EGWABC 3EGWAC
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3EGW BC;  3EGW ABC;  3EGW AC; 
#chains in the LinkProt database with same CATH topology
 3EGW BC;  3EGW ABC;  3EGW AC; 
#chains in the LinkProt database with same CATH homology
 3EGW BC;  3EGW ABC;  3EGW AC; 

1Y5IA 1Q16A 1Y4ZA 1R27A 1R27C 1SIWA 3IR5A 1Y5LA 1Y5NA 3IR7A 3IR6A 1Y5IC 1Q16C 1Y4ZC 1SIWC 3IR5C 1Y5LC 1Y5NC 3IR7C 3IR6C
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1Y5I_A;  1Q16_A;  1Y4Z_A;  1R27_A;  1R27_C;  1SIW_A;  3IR5_A;  1Y5L_A;  1Y5N_A;  3IR7_A;  3IR6_A;  1Y5I_C;  1Q16_C;  1Y4Z_C;  1SIW_C;  3IR5_C;  1Y5L_C;  1Y5N_C;  3IR7_C;  3IR6_C; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling