3DYUAB

Crystal structure of snx9px-bar (230-595), h32
Link type Probability Chain A piercings Chain B piercings
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
view details
Unlink Unlink 43% +441A -474A +571A -595A
Interpreting sequences
Chain A Sequence
EKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
Chain A Sequence
EKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM
sequence length 366,366
structure length 366,366
publication title Structure and plasticity of endophilin and sorting nexin 9.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords Sorting nexin-9
source organism Homo sapiens
pdb deposition date2008-07-28
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF00787 PXPX domain
AB PF10456 BAR_3_WASP_bdgWASP-binding domain of Sorting nexin protein
AB PF00787 PXPX domain
AB PF10456 BAR_3_WASP_bdgWASP-binding domain of Sorting nexin protein
Image from the rcsb pdb (www.rcsb.org)

3DYTA 2RAJA 4AKVA 4AKVB 2RAKA 2RAIA 2RAIB 3DYUB 3DYUC 3DYTA 2RAJA 4AKVA 4AKVB 2RAKA 2RAIA 2RAIB 3DYUA 3DYUC
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 3DYT_A;  2RAJ_A;  4AKV_A;  4AKV_B;  2RAK_A;  2RAI_A;  2RAI_B;  3DYU_B;  3DYU_C;  3DYT_A;  2RAJ_A;  4AKV_A;  4AKV_B;  2RAK_A;  2RAI_A;  2RAI_B;  3DYU_A;  3DYU_C; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling