3DKNAC

Sec61 in the canine ribosome-channel complex from the endoplasmic reticulum
Link type Probability Chain A piercings Chain C piercings
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
view details
Unlink Unlink 40% +13A +156A -257A +338A -375A -431A
Interpreting sequences
Chain A Sequence
KKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKL
Chain A Sequence
ETFSKIRVKPEHVIGVTVAFVIIEAILTYGRF
sequence length 430,32
structure length 430,32
publication title Single copies of Sec61 and TRAP associate with a nontranslating mammalian ribosome.
pubmed doi rcsb
molecule tags Protein transport/rna
molecule keywords RNA (5'-R(P*CP*GP*UP*GP*CP*CP*AP*AP*GP*CP*UP*GP*CP*GP*AP*UP*AP*AP*GP*C)-3')
pdb deposition date2008-06-25
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AC PF00344 SecYSecY translocase
AC PF03911 Sec61_betaSec61beta family
Image from the rcsb pdb (www.rcsb.org)

1RH5A 3MP7A 1RHZA 2YXQA 2YXRA 4V4NAX 4V7IAA 3BO0A 3BO1A 3BO0C 3BO1C
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1RH5_A;  3MP7_A;  1RHZ_A;  2YXQ_A;  2YXR_A;  4V4N_AX;  4V7I_AA;  3BO0_A;  3BO1_A;  3BO0_C;  3BO1_C; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling