3DIEAB

Domain swapping of staphylococcus aureus thioredoxin w28a mutant
Link type Probability Chain A piercings Chain B piercings
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
view details
Hopf.1 Hopf.1 39% +25B -37B +54B +24A +61A -104A
Interpreting sequences
Chain A Sequence
SHMAIVKVTDADFDSKVESGVQLVDFWATACGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
Chain A Sequence
SHMAIVKVTDADFDSKVESGVQLVDFWATACGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL
sequence length 106,106
structure length 106,106
publication title Coupling of domain swapping to kinetic stability in a thioredoxin mutant
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Thioredoxin
source organism Staphylococcus aureus
pdb deposition date2008-06-20
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF00085 ThioredoxinThioredoxin
AB PF00085 ThioredoxinThioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dieA01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3dieB01
3HXSAB 1OC3ABC 1OC3AC 1A0RBGP 1OC3BC 1QQ2AB 1A0RBP 3DIEAB
chains in the LinkProt database with same CATH superfamily
3HXSAB 1OC3ABC 1OC3AC 1A0RBGP 1OC3BC 1QQ2AB 1A0RBP 3DIEAB
chains in the LinkProt database with same CATH topology
3HXSAB 1OC3ABC 1OC3AC 1A0RBGP 1OC3BC 1QQ2AB 1A0RBP 3DIEAB
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 3HXS AB;  1OC3 ABC;  1OC3 AC;  1A0R BGP;  1OC3 BC;  1QQ2 AB;  1A0R BP;  3DIE AB; 
#chains in the LinkProt database with same CATH topology
 3HXS AB;  1OC3 ABC;  1OC3 AC;  1A0R BGP;  1OC3 BC;  1QQ2 AB;  1A0R BP;  3DIE AB; 
#chains in the LinkProt database with same CATH homology
 3HXS AB;  1OC3 ABC;  1OC3 AC;  1A0R BGP;  1OC3 BC;  1QQ2 AB;  1A0R BP;  3DIE AB; 

6Q6TA 4OO4A 4OO4B 2I4AA 5HR3A 5HR3B 3M9JA 3M9JB 4HUAA 5HR2A 4WXTA 2IFQA 2IFQC 2IFQB 6Q6VA 6Q6VB 2HSHA 2YOIA 2YOIB 2YN1A 2YN1B 5HR0A 5HR0B 2J23A 2J23B 2I1UA 5DQYA 4HU7A 4HU7B 6I19A 6I19B 2VIMA 6G62A 2E0QA 1T00A 3M9KA 3M9KB 2VOCA 2VOCB 4HU9A 4AJ8A 4AJ8B 4OO5A 6Q47A 6Q47B 3NOFA 3NOFB 5G30A 5G30B 5G30C 5G30D 2TRXA 2TRXB 4X43A 4X43B 4X43C 2YJ7A 2YJ7B 4POBA 4POBB 4V2LA 4V2LB 2HXKA 2HXKB 2HXKC 2YNXA 2YNXB 2VM1A 2VM1B 2VM1C 2VM1D 6Q46A 6Q46B 5JY5A 5JY5B 1ERVA 1W4VA 1W4VB 1W4VC 1W4VD 1W4VE 1W4VF 2VLUA 2VLUB 2VLVA 2VLVB 1ERTA 2IIYA 1KEBA 1KEBB 6GN9A 3F3RA 3F3RB 3F3QA 2VM2A 2VM2B 2VM2C 2VM2D 4V2MA 4V2MB 2OE3A 2OE3B 3KD0A 3DIEB 3HHVA 3ZZXA 3ZZXB 1ERWA 5G2ZA 5G2ZB 4KNDA 4KNDB 2EIQA 2EIQB 3TCOA 3TCOB 3TCOC 6G61A 6Q6UA 6Q6UB 2OE0A 2OE0B 4POMA 4POMB 4POMC 4POMD 1AIUA 4AJ7A 4AJ7B 2OE1A 2OE1B 4I8BA 4I8BB 2VLTA 2VLTB 4AJ6A 4AJ6B 5YKWA 2TIRA 5DBQA 5DBQB 1NW2A 1NW2B 1NW2C 1NW2D 1NW2E 1NW2F 1NW2G 1NW2H 1UVZA 1UVZB 1UVZC 1UVZD 1UVZE 1UVZF 1NSWA 1NSWB 1NSWC 1NSWD 5G31A 1AUCA 2YPMA 3E3EA 3E3EB 1TXXA 4V2NA 4V2NB 1W89A 1W89B 1W89C 1W89D 1W89E 1W89F 2YZUA 4LL1B 4LL1D 1FB6A 1FB6B 1EP7A 1EP7B 2CVKA 1X9MB 1THOA 5HR1A 5HR1B 5HR1C 5HR1D 5HR1E 5HR1F 5HR1G 2O85A 1EP8A 1EP8B 1ERUA 4DSSB 2O7KA 6BKVA 6BKVB 3DYRA 3DYRB 4BA7A 4BA7B 1FB0A 1FB0B 2H76A 2H76B 1TK5B 4TN8A 2H6YA 2H6YB 1XWAA 1XWAB 1XWAC 1XWAD 1XWBA 1XWBB 1XWBC 1XWBD 2H71A 2H71B 4ULXA 2O87A 2FD3A 2FD3B 2H75A 2H75B 1TK0B 3QFAC 3QFAD 2H72A 2H72B 1XW9A 1XW9B 1XW9C 1XW9D 3O6TA 3O6TB 3O6TC 3O6TD 1T7PB 1XWCA 1SL1B 2FA4A 2FA4B 2IWTA 2H74A 2H74B 2H6ZA 2H6ZB 1ZCPA 1ZCPB 1ZCPC 1ZCPD 1X9WB 1SKSB 1TKDB 2BTOT 2H73A 2H73B 1SKWB 1TK8B 3ZIVA 3ZIVB 3ZIVC 1SKRB 2O89A 1SL2B 4J56E 4J56F 4J56G 4J56H 2FCHA 2FCHB 2FCHC 2FCHD 2FCHE 2FCHF 2FCHG 4J57E 4J57F 1ZZYA 1ZZYB 1T8EB 4LL4B 4LL4D 2EIRA 2EIRB 2EIRC 2EIRD 2H6XA 2H6XB 2H70A 2H70B 4POKA 4POKB 4POKC 4POKD 2EIOA 2EIOB 2EIOC 2EIOD 2AJQB 2AJQI 6H7NE 6H7NF 3QFBC 3QFBD 1ZYQB 1X9SB 1SYRA 1SYRB 1SYRC 1SYRD 1SYRE 1SYRF 1SYRG 1SYRH 1SYRI 1SYRJ 1SYRK 1SYRL 3PINA 1F6MC 1F6MD 1F6MG 1F6MH 6H1YA 6H1YB 6H7LE 6H7LF 6H7OE 6H7OF 4POLA 4POLB 4POLC 4POLD 6GNDB 6GNDD 6GNDF 6GNDH 5E4WA 5E4WB 6H7ME 6H7MF 2PUKC 2PUKG 6H7JE 6H7JF 1SL0B 1SL0D 4PUFC 4PUFD 5IKNK 5IKNL 5IKNM 6N7WI 6AP5A 5VO7A 2N5AA 2N5BA 2MMNA 2MMOA 2L59A 2L4QA 2IPAA 2I9HA 2HSYA 2GZYA 2GZZA 1XFLA 1WMJA 1TI3A 1RQMA 1M7TA 1GL8A 1DBYA 1QUWA 1TOFA 1CQGA 1CQHA 1XOAA 1XOBA 1MDIA 1MDJA 1MDKA 1TRSA 1TRUA 1TRVA 1TRWA 3TRXA 4TRXA 1SRXA 6Q6TA 4OO4A 4OO4B 2I4AA 5HR3A 5HR3B 3M9JA 3M9JB 4HUAA 5HR2A 4WXTA 2IFQA 2IFQC 2IFQB 6Q6VA 6Q6VB 2HSHA 2YOIA 2YOIB 2YN1A 2YN1B 5HR0A 5HR0B 2J23A 2J23B 2I1UA 5DQYA 4HU7A 4HU7B 6I19A 6I19B 2VIMA 6G62A 2E0QA 1T00A 3M9KA 3M9KB 2VOCA 2VOCB 4HU9A 4AJ8A 4AJ8B 4OO5A 6Q47A 6Q47B 3NOFA 3NOFB 5G30A 5G30B 5G30C 5G30D 2TRXA 2TRXB 4X43A 4X43B 4X43C 2YJ7A 2YJ7B 4POBA 4POBB 4V2LA 4V2LB 2HXKA 2HXKB 2HXKC 2YNXA 2YNXB 2VM1A 2VM1B 2VM1C 2VM1D 6Q46A 6Q46B 5JY5A 5JY5B 1ERVA 1W4VA 1W4VB 1W4VC 1W4VD 1W4VE 1W4VF 2VLUA 2VLUB 2VLVA 2VLVB 1ERTA 2IIYA 1KEBA 1KEBB 6GN9A 3F3RA 3F3RB 3F3QA 2VM2A 2VM2B 2VM2C 2VM2D 4V2MA 4V2MB 2OE3A 2OE3B 3KD0A 3DIEA 3HHVA 3ZZXA 3ZZXB 1ERWA 5G2ZA 5G2ZB 4KNDA 4KNDB 2EIQA 2EIQB 3TCOA 3TCOB 3TCOC 6G61A 6Q6UA 6Q6UB 2OE0A 2OE0B 4POMA 4POMB 4POMC 4POMD 1AIUA 4AJ7A 4AJ7B 2OE1A 2OE1B 4I8BA 4I8BB 2VLTA 2VLTB 4AJ6A 4AJ6B 5YKWA 2TIRA 5DBQA 5DBQB 1NW2A 1NW2B 1NW2C 1NW2D 1NW2E 1NW2F 1NW2G 1NW2H 1UVZA 1UVZB 1UVZC 1UVZD 1UVZE 1UVZF 1NSWA 1NSWB 1NSWC 1NSWD 5G31A 1AUCA 2YPMA 3E3EA 3E3EB 1TXXA 4V2NA 4V2NB 1W89A 1W89B 1W89C 1W89D 1W89E 1W89F 2YZUA 4LL1B 4LL1D 1FB6A 1FB6B 1EP7A 1EP7B 2CVKA 1X9MB 1THOA 5HR1A 5HR1B 5HR1C 5HR1D 5HR1E 5HR1F 5HR1G 2O85A 1EP8A 1EP8B 1ERUA 4DSSB 2O7KA 6BKVA 6BKVB 3DYRA 3DYRB 4BA7A 4BA7B 1FB0A 1FB0B 2H76A 2H76B 1TK5B 4TN8A 2H6YA 2H6YB 1XWAA 1XWAB 1XWAC 1XWAD 1XWBA 1XWBB 1XWBC 1XWBD 2H71A 2H71B 4ULXA 2O87A 2FD3A 2FD3B 2H75A 2H75B 1TK0B 3QFAC 3QFAD 2H72A 2H72B 1XW9A 1XW9B 1XW9C 1XW9D 3O6TA 3O6TB 3O6TC 3O6TD 1T7PB 1XWCA 1SL1B 2FA4A 2FA4B 2IWTA 2H74A 2H74B 2H6ZA 2H6ZB 1ZCPA 1ZCPB 1ZCPC 1ZCPD 1X9WB 1SKSB 1TKDB 2BTOT 2H73A 2H73B 1SKWB 1TK8B 3ZIVA 3ZIVB 3ZIVC 1SKRB 2O89A 1SL2B 4J56E 4J56F 4J56G 4J56H 2FCHA 2FCHB 2FCHC 2FCHD 2FCHE 2FCHF 2FCHG 4J57E 4J57F 1ZZYA 1ZZYB 1T8EB 4LL4B 4LL4D 2EIRA 2EIRB 2EIRC 2EIRD 2H6XA 2H6XB 2H70A 2H70B 4POKA 4POKB 4POKC 4POKD 2EIOA 2EIOB 2EIOC 2EIOD 2AJQB 2AJQI 6H7NE 6H7NF 3QFBC 3QFBD 1ZYQB 1X9SB 1SYRA 1SYRB 1SYRC 1SYRD 1SYRE 1SYRF 1SYRG 1SYRH 1SYRI 1SYRJ 1SYRK 1SYRL 3PINA 1F6MC 1F6MD 1F6MG 1F6MH 6H1YA 6H1YB 6H7LE 6H7LF 6H7OE 6H7OF 4POLA 4POLB 4POLC 4POLD 6GNDB 6GNDD 6GNDF 6GNDH 5E4WA 5E4WB 6H7ME 6H7MF 2PUKC 2PUKG 6H7JE 6H7JF 1SL0B 1SL0D 4PUFC 4PUFD 5IKNK 5IKNL 5IKNM 6N7WI 6AP5A 5VO7A 2N5AA 2N5BA 2MMNA 2MMOA 2L59A 2L4QA 2IPAA 2I9HA 2HSYA 2GZYA 2GZZA 1XFLA 1WMJA 1TI3A 1RQMA 1M7TA 1GL8A 1DBYA 1QUWA 1TOFA 1CQGA 1CQHA 1XOAA 1XOBA 1MDIA 1MDJA 1MDKA 1TRSA 1TRUA 1TRVA 1TRWA 3TRXA 4TRXA 1SRXA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 6Q6T_A;  4OO4_A;  4OO4_B;  2I4A_A;  5HR3_A;  5HR3_B;  3M9J_A;  3M9J_B;  4HUA_A;  5HR2_A;  4WXT_A;  2IFQ_A;  2IFQ_C;  2IFQ_B;  6Q6V_A;  6Q6V_B;  2HSH_A;  2YOI_A;  2YOI_B;  2YN1_A;  2YN1_B;  5HR0_A;  5HR0_B;  2J23_A;  2J23_B;  2I1U_A;  5DQY_A;  4HU7_A;  4HU7_B;  6I19_A;  6I19_B;  2VIM_A;  6G62_A;  2E0Q_A;  1T00_A;  3M9K_A;  3M9K_B;  2VOC_A;  2VOC_B;  4HU9_A;  4AJ8_A;  4AJ8_B;  4OO5_A;  6Q47_A;  6Q47_B;  3NOF_A;  3NOF_B;  5G30_A;  5G30_B;  5G30_C;  5G30_D;  2TRX_A;  2TRX_B;  4X43_A;  4X43_B;  4X43_C;  2YJ7_A;  2YJ7_B;  4POB_A;  4POB_B;  4V2L_A;  4V2L_B;  2HXK_A;  2HXK_B;  2HXK_C;  2YNX_A;  2YNX_B;  2VM1_A;  2VM1_B;  2VM1_C;  2VM1_D;  6Q46_A;  6Q46_B;  5JY5_A;  5JY5_B;  1ERV_A;  1W4V_A;  1W4V_B;  1W4V_C;  1W4V_D;  1W4V_E;  1W4V_F;  2VLU_A;  2VLU_B;  2VLV_A;  2VLV_B;  1ERT_A;  2IIY_A;  1KEB_A;  1KEB_B;  6GN9_A;  3F3R_A;  3F3R_B;  3F3Q_A;  2VM2_A;  2VM2_B;  2VM2_C;  2VM2_D;  4V2M_A;  4V2M_B;  2OE3_A;  2OE3_B;  3KD0_A;  3DIE_B;  3HHV_A;  3ZZX_A;  3ZZX_B;  1ERW_A;  5G2Z_A;  5G2Z_B;  4KND_A;  4KND_B;  2EIQ_A;  2EIQ_B;  3TCO_A;  3TCO_B;  3TCO_C;  6G61_A;  6Q6U_A;  6Q6U_B;  2OE0_A;  2OE0_B;  4POM_A;  4POM_B;  4POM_C;  4POM_D;  1AIU_A;  4AJ7_A;  4AJ7_B;  2OE1_A;  2OE1_B;  4I8B_A;  4I8B_B;  2VLT_A;  2VLT_B;  4AJ6_A;  4AJ6_B;  5YKW_A;  2TIR_A;  5DBQ_A;  5DBQ_B;  1NW2_A;  1NW2_B;  1NW2_C;  1NW2_D;  1NW2_E;  1NW2_F;  1NW2_G;  1NW2_H;  1UVZ_A;  1UVZ_B;  1UVZ_C;  1UVZ_D;  1UVZ_E;  1UVZ_F;  1NSW_A;  1NSW_B;  1NSW_C;  1NSW_D;  5G31_A;  1AUC_A;  2YPM_A;  3E3E_A;  3E3E_B;  1TXX_A;  4V2N_A;  4V2N_B;  1W89_A;  1W89_B;  1W89_C;  1W89_D;  1W89_E;  1W89_F;  2YZU_A;  4LL1_B;  4LL1_D;  1FB6_A;  1FB6_B;  1EP7_A;  1EP7_B;  2CVK_A;  1X9M_B;  1THO_A;  5HR1_A;  5HR1_B;  5HR1_C;  5HR1_D;  5HR1_E;  5HR1_F;  5HR1_G;  2O85_A;  1EP8_A;  1EP8_B;  1ERU_A;  4DSS_B;  2O7K_A;  6BKV_A;  6BKV_B;  3DYR_A;  3DYR_B;  4BA7_A;  4BA7_B;  1FB0_A;  1FB0_B;  2H76_A;  2H76_B;  1TK5_B;  4TN8_A;  2H6Y_A;  2H6Y_B;  1XWA_A;  1XWA_B;  1XWA_C;  1XWA_D;  1XWB_A;  1XWB_B;  1XWB_C;  1XWB_D;  2H71_A;  2H71_B;  4ULX_A;  2O87_A;  2FD3_A;  2FD3_B;  2H75_A;  2H75_B;  1TK0_B;  3QFA_C;  3QFA_D;  2H72_A;  2H72_B;  1XW9_A;  1XW9_B;  1XW9_C;  1XW9_D;  3O6T_A;  3O6T_B;  3O6T_C;  3O6T_D;  1T7P_B;  1XWC_A;  1SL1_B;  2FA4_A;  2FA4_B;  2IWT_A;  2H74_A;  2H74_B;  2H6Z_A;  2H6Z_B;  1ZCP_A;  1ZCP_B;  1ZCP_C;  1ZCP_D;  1X9W_B;  1SKS_B;  1TKD_B;  2BTO_T;  2H73_A;  2H73_B;  1SKW_B;  1TK8_B;  3ZIV_A;  3ZIV_B;  3ZIV_C;  1SKR_B;  2O89_A;  1SL2_B;  4J56_E;  4J56_F;  4J56_G;  4J56_H;  2FCH_A;  2FCH_B;  2FCH_C;  2FCH_D;  2FCH_E;  2FCH_F;  2FCH_G;  4J57_E;  4J57_F;  1ZZY_A;  1ZZY_B;  1T8E_B;  4LL4_B;  4LL4_D;  2EIR_A;  2EIR_B;  2EIR_C;  2EIR_D;  2H6X_A;  2H6X_B;  2H70_A;  2H70_B;  4POK_A;  4POK_B;  4POK_C;  4POK_D;  2EIO_A;  2EIO_B;  2EIO_C;  2EIO_D;  2AJQ_B;  2AJQ_I;  6H7N_E;  6H7N_F;  3QFB_C;  3QFB_D;  1ZYQ_B;  1X9S_B;  1SYR_A;  1SYR_B;  1SYR_C;  1SYR_D;  1SYR_E;  1SYR_F;  1SYR_G;  1SYR_H;  1SYR_I;  1SYR_J;  1SYR_K;  1SYR_L;  3PIN_A;  1F6M_C;  1F6M_D;  1F6M_G;  1F6M_H;  6H1Y_A;  6H1Y_B;  6H7L_E;  6H7L_F;  6H7O_E;  6H7O_F;  4POL_A;  4POL_B;  4POL_C;  4POL_D;  6GND_B;  6GND_D;  6GND_F;  6GND_H;  5E4W_A;  5E4W_B;  6H7M_E;  6H7M_F;  2PUK_C;  2PUK_G;  6H7J_E;  6H7J_F;  1SL0_B;  1SL0_D;  4PUF_C;  4PUF_D;  5IKN_K;  5IKN_L;  5IKN_M;  6N7W_I;  6AP5_A;  5VO7_A;  2N5A_A;  2N5B_A;  2MMN_A;  2MMO_A;  2L59_A;  2L4Q_A;  2IPA_A;  2I9H_A;  2HSY_A;  2GZY_A;  2GZZ_A;  1XFL_A;  1WMJ_A;  1TI3_A;  1RQM_A;  1M7T_A;  1GL8_A;  1DBY_A;  1QUW_A;  1TOF_A;  1CQG_A;  1CQH_A;  1XOA_A;  1XOB_A;  1MDI_A;  1MDJ_A;  1MDK_A;  1TRS_A;  1TRU_A;  1TRV_A;  1TRW_A;  3TRX_A;  4TRX_A;  1SRX_A;  6Q6T_A;  4OO4_A;  4OO4_B;  2I4A_A;  5HR3_A;  5HR3_B;  3M9J_A;  3M9J_B;  4HUA_A;  5HR2_A;  4WXT_A;  2IFQ_A;  2IFQ_C;  2IFQ_B;  6Q6V_A;  6Q6V_B;  2HSH_A;  2YOI_A;  2YOI_B;  2YN1_A;  2YN1_B;  5HR0_A;  5HR0_B;  2J23_A;  2J23_B;  2I1U_A;  5DQY_A;  4HU7_A;  4HU7_B;  6I19_A;  6I19_B;  2VIM_A;  6G62_A;  2E0Q_A;  1T00_A;  3M9K_A;  3M9K_B;  2VOC_A;  2VOC_B;  4HU9_A;  4AJ8_A;  4AJ8_B;  4OO5_A;  6Q47_A;  6Q47_B;  3NOF_A;  3NOF_B;  5G30_A;  5G30_B;  5G30_C;  5G30_D;  2TRX_A;  2TRX_B;  4X43_A;  4X43_B;  4X43_C;  2YJ7_A;  2YJ7_B;  4POB_A;  4POB_B;  4V2L_A;  4V2L_B;  2HXK_A;  2HXK_B;  2HXK_C;  2YNX_A;  2YNX_B;  2VM1_A;  2VM1_B;  2VM1_C;  2VM1_D;  6Q46_A;  6Q46_B;  5JY5_A;  5JY5_B;  1ERV_A;  1W4V_A;  1W4V_B;  1W4V_C;  1W4V_D;  1W4V_E;  1W4V_F;  2VLU_A;  2VLU_B;  2VLV_A;  2VLV_B;  1ERT_A;  2IIY_A;  1KEB_A;  1KEB_B;  6GN9_A;  3F3R_A;  3F3R_B;  3F3Q_A;  2VM2_A;  2VM2_B;  2VM2_C;  2VM2_D;  4V2M_A;  4V2M_B;  2OE3_A;  2OE3_B;  3KD0_A;  3DIE_A;  3HHV_A;  3ZZX_A;  3ZZX_B;  1ERW_A;  5G2Z_A;  5G2Z_B;  4KND_A;  4KND_B;  2EIQ_A;  2EIQ_B;  3TCO_A;  3TCO_B;  3TCO_C;  6G61_A;  6Q6U_A;  6Q6U_B;  2OE0_A;  2OE0_B;  4POM_A;  4POM_B;  4POM_C;  4POM_D;  1AIU_A;  4AJ7_A;  4AJ7_B;  2OE1_A;  2OE1_B;  4I8B_A;  4I8B_B;  2VLT_A;  2VLT_B;  4AJ6_A;  4AJ6_B;  5YKW_A;  2TIR_A;  5DBQ_A;  5DBQ_B;  1NW2_A;  1NW2_B;  1NW2_C;  1NW2_D;  1NW2_E;  1NW2_F;  1NW2_G;  1NW2_H;  1UVZ_A;  1UVZ_B;  1UVZ_C;  1UVZ_D;  1UVZ_E;  1UVZ_F;  1NSW_A;  1NSW_B;  1NSW_C;  1NSW_D;  5G31_A;  1AUC_A;  2YPM_A;  3E3E_A;  3E3E_B;  1TXX_A;  4V2N_A;  4V2N_B;  1W89_A;  1W89_B;  1W89_C;  1W89_D;  1W89_E;  1W89_F;  2YZU_A;  4LL1_B;  4LL1_D;  1FB6_A;  1FB6_B;  1EP7_A;  1EP7_B;  2CVK_A;  1X9M_B;  1THO_A;  5HR1_A;  5HR1_B;  5HR1_C;  5HR1_D;  5HR1_E;  5HR1_F;  5HR1_G;  2O85_A;  1EP8_A;  1EP8_B;  1ERU_A;  4DSS_B;  2O7K_A;  6BKV_A;  6BKV_B;  3DYR_A;  3DYR_B;  4BA7_A;  4BA7_B;  1FB0_A;  1FB0_B;  2H76_A;  2H76_B;  1TK5_B;  4TN8_A;  2H6Y_A;  2H6Y_B;  1XWA_A;  1XWA_B;  1XWA_C;  1XWA_D;  1XWB_A;  1XWB_B;  1XWB_C;  1XWB_D;  2H71_A;  2H71_B;  4ULX_A;  2O87_A;  2FD3_A;  2FD3_B;  2H75_A;  2H75_B;  1TK0_B;  3QFA_C;  3QFA_D;  2H72_A;  2H72_B;  1XW9_A;  1XW9_B;  1XW9_C;  1XW9_D;  3O6T_A;  3O6T_B;  3O6T_C;  3O6T_D;  1T7P_B;  1XWC_A;  1SL1_B;  2FA4_A;  2FA4_B;  2IWT_A;  2H74_A;  2H74_B;  2H6Z_A;  2H6Z_B;  1ZCP_A;  1ZCP_B;  1ZCP_C;  1ZCP_D;  1X9W_B;  1SKS_B;  1TKD_B;  2BTO_T;  2H73_A;  2H73_B;  1SKW_B;  1TK8_B;  3ZIV_A;  3ZIV_B;  3ZIV_C;  1SKR_B;  2O89_A;  1SL2_B;  4J56_E;  4J56_F;  4J56_G;  4J56_H;  2FCH_A;  2FCH_B;  2FCH_C;  2FCH_D;  2FCH_E;  2FCH_F;  2FCH_G;  4J57_E;  4J57_F;  1ZZY_A;  1ZZY_B;  1T8E_B;  4LL4_B;  4LL4_D;  2EIR_A;  2EIR_B;  2EIR_C;  2EIR_D;  2H6X_A;  2H6X_B;  2H70_A;  2H70_B;  4POK_A;  4POK_B;  4POK_C;  4POK_D;  2EIO_A;  2EIO_B;  2EIO_C;  2EIO_D;  2AJQ_B;  2AJQ_I;  6H7N_E;  6H7N_F;  3QFB_C;  3QFB_D;  1ZYQ_B;  1X9S_B;  1SYR_A;  1SYR_B;  1SYR_C;  1SYR_D;  1SYR_E;  1SYR_F;  1SYR_G;  1SYR_H;  1SYR_I;  1SYR_J;  1SYR_K;  1SYR_L;  3PIN_A;  1F6M_C;  1F6M_D;  1F6M_G;  1F6M_H;  6H1Y_A;  6H1Y_B;  6H7L_E;  6H7L_F;  6H7O_E;  6H7O_F;  4POL_A;  4POL_B;  4POL_C;  4POL_D;  6GND_B;  6GND_D;  6GND_F;  6GND_H;  5E4W_A;  5E4W_B;  6H7M_E;  6H7M_F;  2PUK_C;  2PUK_G;  6H7J_E;  6H7J_F;  1SL0_B;  1SL0_D;  4PUF_C;  4PUF_D;  5IKN_K;  5IKN_L;  5IKN_M;  6N7W_I;  6AP5_A;  5VO7_A;  2N5A_A;  2N5B_A;  2MMN_A;  2MMO_A;  2L59_A;  2L4Q_A;  2IPA_A;  2I9H_A;  2HSY_A;  2GZY_A;  2GZZ_A;  1XFL_A;  1WMJ_A;  1TI3_A;  1RQM_A;  1M7T_A;  1GL8_A;  1DBY_A;  1QUW_A;  1TOF_A;  1CQG_A;  1CQH_A;  1XOA_A;  1XOB_A;  1MDI_A;  1MDJ_A;  1MDK_A;  1TRS_A;  1TRU_A;  1TRV_A;  1TRW_A;  3TRX_A;  4TRX_A;  1SRX_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling