| Link type | Probability | Chain A piercings | Chain B piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
| view details |
|
Hopf.1 | 39% | +25B -37B +54B | +24A +61A -104A | ||||||||
Chain A Sequence |
SHMAIVKVTDADFDSKVESGVQLVDFWATACGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL |
Chain A Sequence |
SHMAIVKVTDADFDSKVESGVQLVDFWATACGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKDGQPVDKVVGFQPKENLAEVLDKHL |
| sequence length | 106,106 |
| structure length | 106,106 |
| publication title |
Coupling of domain swapping to kinetic stability in a thioredoxin mutant
pubmed doi rcsb |
| molecule tags | Electron transport |
| molecule keywords | Thioredoxin |
| source organism | Staphylococcus aureus |
| pdb deposition date | 2008-06-20 |
| LinkProt deposition date | 2016-08-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| AB | PF00085 | Thioredoxin | Thioredoxin |
| AB | PF00085 | Thioredoxin | Thioredoxin |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin |
#chains in the LinkProt database with same CATH superfamily 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB; #chains in the LinkProt database with same CATH topology 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB; #chains in the LinkProt database with same CATH homology 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
