Link type | Probability | Chain B piercings | Chain C piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B | ||||||||||
view details | Unlink | 75% | -40B +96B +121B -161B |
Chain B Sequence |
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL |
Chain B Sequence |
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL |
sequence length | 161,161 |
structure length | 161,161 |
publication title |
Crystal Structure of a Dimeric Oxidized Form of Human Peroxiredoxin 5
pubmed doi rcsb |
molecule tags | Oxidoreductase |
molecule keywords | PEROXIREDOXIN 5 |
source organism | Homo sapiens |
ec nomenclature |
ec 1.11.1.15: Peroxiredoxin. ec 1.11.1.15: Peroxiredoxin. |
pdb deposition date | 2003-02-05 |
LinkProt deposition date | 2016-10-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
BC | PF08534 | Redoxin | Redoxin |
BC | PF08534 | Redoxin | Redoxin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin | ||
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin |
#chains in the LinkProt database with same CATH superfamily 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB; #chains in the LinkProt database with same CATH topology 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB; #chains in the LinkProt database with same CATH homology 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...