| Link type | Probability | Chain B piercings | Chain C piercings | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
| view details |
|
Unlink | 75% | -40B +96B +121B -161B | |||||||||
Chain B Sequence |
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL |
Chain B Sequence |
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL |
| sequence length | 161,161 |
| structure length | 161,161 |
| publication title |
Crystal Structure of a Dimeric Oxidized Form of Human Peroxiredoxin 5
pubmed doi rcsb |
| molecule tags | Oxidoreductase |
| molecule keywords | PEROXIREDOXIN 5 |
| source organism | Homo sapiens |
| ec nomenclature |
ec 1.11.1.15: Peroxiredoxin. ec 1.11.1.15: Peroxiredoxin. |
| pdb deposition date | 2003-02-05 |
| LinkProt deposition date | 2016-10-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| BC | PF08534 | Redoxin | Redoxin |
| BC | PF08534 | Redoxin | Redoxin |
Image from the rcsb pdb (www.rcsb.org)cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin |
#chains in the LinkProt database with same CATH superfamily 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB; #chains in the LinkProt database with same CATH topology 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB; #chains in the LinkProt database with same CATH homology 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BP; 3DIE AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...