1FZRABCD

Crystal structure of bacteriophage t7 endonuclease i
Link type Probability Chain A piercings Chain B piercings Chain C piercings Chain D piercings
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
view details
Other Other 86% -50B -146B -42C -52C -79C +146C -146D -52A +68A -84A +98A -116A +40B -146B
Interpreting sequences
Chain A Sequence
SGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFLLPNGIFVKTKGLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKHGIKFADKLIPAEWIKEPKKEVPFDRLKRK
Chain A Sequence
SGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFLLPNGIFVKTKGLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKHGIKFADKLIPAEWIKEPKKEVPFDRLKRK
Chain A Sequence
SGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFLLPNGIFVKTKGLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKHGIKFADKLIPAEWIKEPKKEVPFDRLKRK
Chain A Sequence
SGLEDKVSKQLESKGIKFEYEEWKVPYVIPASNHTYTPDFLLPNGIFVKTKGLWESDDRKKHLLIREQHPELDIRIVFSSSRTKLYKGSPTSYGEFCEKHGIKFADKLIPAEWIKEPKKEVPFDRLKRK
sequence length 129,129,129,129
structure length 129,129,129,129
publication title Crystal structure of the Holliday junction resolving enzyme T7 endonuclease I.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDONUCLEASE I
source organism Enterobacteria phage t7
ec nomenclature ec 3.1.21.2: Deoxyribonuclease IV.
ec 3.1.21.2: Deoxyribonuclease IV.
ec 3.1.21.2: Deoxyribonuclease IV.
ec 3.1.21.2: Deoxyribonuclease IV.
pdb deposition date2000-10-04
LinkProt deposition date2016-08-22

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABCD PF05367 Phage_endo_IPhage endonuclease I
ABCD PF05367 Phage_endo_IPhage endonuclease I
ABCD PF05367 Phage_endo_IPhage endonuclease I
ABCD PF05367 Phage_endo_IPhage endonuclease I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.91.30 Alpha Beta 3-Layer(aba) Sandwich Restriction Endonuclease Restriction Endonuclease 1fzrA00
3.40.91.30 Alpha Beta 3-Layer(aba) Sandwich Restriction Endonuclease Restriction Endonuclease 1fzrB00
3.40.91.30 Alpha Beta 3-Layer(aba) Sandwich Restriction Endonuclease Restriction Endonuclease 1fzrC00
3.40.91.30 Alpha Beta 3-Layer(aba) Sandwich Restriction Endonuclease Restriction Endonuclease 1fzrD00
1M0DCD 1M0DBD 1M0IACD 1M0DAC 1M0IAD 1FZRBD 1FZRAC 1FZRBC 1M0DABCD 1M0DAB 1FZRAD 1M0IABD 1FZRACD 1M0ICD 1M0IBC 1M0DABD 1FZRABCD 1FZRABD 1M0IABCD 1M0IAB 1M0DAD 1FZRCD 1M0DACD 1M0DBC 1M0IBCD 1FZRAB 1M0DBCD 1M0DABC 1M0IAC 1M0IBD 1FZRBCD 1FZRABC 1M0IABC
chains in the LinkProt database with same CATH superfamily
1M0DCD 1M0DBD 1M0IACD 1M0DAC 1M0IAD 1FZRBD 1FZRAC 1FZRBC 1M0DABCD 1M0DAB 1FZRAD 1M0IABD 1FZRACD 1M0ICD 1M0IBC 1M0DABD 1FZRABCD 1FZRABD 1M0IABCD 1M0IAB 1M0DAD 1FZRCD 1M0DACD 1M0DBC 1M0IBCD 1FZRAB 1M0DBCD 1M0DABC 1M0IAC 1M0IBD 1FZRBCD 1FZRABC 1M0IABC
chains in the LinkProt database with same CATH topology
1M0DCD 1M0DBD 1M0IACD 1M0DAC 1M0IAD 1FZRBD 1FZRAC 1FZRBC 1M0DABCD 1M0DAB 1FZRAD 1M0IABD 1FZRACD 1M0ICD 1M0IBC 1M0DABD 1FZRABCD 1FZRABD 1M0IABCD 1M0IAB 1M0DAD 1FZRCD 1M0DACD 1M0DBC 1M0IBCD 1FZRAB 1M0DBCD 1M0DABC 1M0IAC 1M0IBD 1FZRBCD 1FZRABC 1M0IABC
chains in the LinkProt database with same CATH homology


 
#chains in the LinkProt database with same CATH superfamily
 1M0D CD;  1M0D BD;  1M0I ACD;  1M0D AC;  1M0I AD;  1FZR BD;  1FZR AC;  1FZR BC;  1M0D ABCD;  1M0D AB;  1FZR AD;  1M0I ABD;  1FZR ACD;  1M0I CD;  1M0I BC;  1M0D ABD;  1FZR ABCD;  1FZR ABD;  1M0I ABCD;  1M0I AB;  1M0D AD;  1FZR CD;  1M0D ACD;  1M0D BC;  1M0I BCD;  1FZR AB;  1M0D BCD;  1M0D ABC;  1M0I AC;  1M0I BD;  1FZR BCD;  1FZR ABC;  1M0I ABC; 
#chains in the LinkProt database with same CATH topology
 1M0D CD;  1M0D BD;  1M0I ACD;  1M0D AC;  1M0I AD;  1FZR BD;  1FZR AC;  1FZR BC;  1M0D ABCD;  1M0D AB;  1FZR AD;  1M0I ABD;  1FZR ACD;  1M0I CD;  1M0I BC;  1M0D ABD;  1FZR ABCD;  1FZR ABD;  1M0I ABCD;  1M0I AB;  1M0D AD;  1FZR CD;  1M0D ACD;  1M0D BC;  1M0I BCD;  1FZR AB;  1M0D BCD;  1M0D ABC;  1M0I AC;  1M0I BD;  1FZR BCD;  1FZR ABC;  1M0I ABC; 
#chains in the LinkProt database with same CATH homology
 1M0D CD;  1M0D BD;  1M0I ACD;  1M0D AC;  1M0I AD;  1FZR BD;  1FZR AC;  1FZR BC;  1M0D ABCD;  1M0D AB;  1FZR AD;  1M0I ABD;  1FZR ACD;  1M0I CD;  1M0I BC;  1M0D ABD;  1FZR ABCD;  1FZR ABD;  1M0I ABCD;  1M0I AB;  1M0D AD;  1FZR CD;  1M0D ACD;  1M0D BC;  1M0I BCD;  1FZR AB;  1M0D BCD;  1M0D ABC;  1M0I AC;  1M0I BD;  1FZR BCD;  1FZR ABC;  1M0I ABC; 

1M0DA 1M0DB 1M0DC 1M0DD 1FZRB 1FZRC 1FZRD 1M0IA 1M0IB 1M0IC 1M0ID 3CAEA 3CAEB 3CAEC 3CAED 3CAEE 3CAEF 3CAEG 3CAEH 3CAEI 3CAEJ 2PFJA 2PFJB 1M0DA 1M0DB 1M0DC 1M0DD 1FZRA 1FZRC 1FZRD 1M0IA 1M0IB 1M0IC 1M0ID 3CAEA 3CAEB 3CAEC 3CAED 3CAEE 3CAEF 3CAEG 3CAEH 3CAEI 3CAEJ 2PFJA 2PFJB 1M0DA 1M0DB 1M0DC 1M0DD 1FZRA 1FZRB 1FZRD 1M0IA 1M0IB 1M0IC 1M0ID 3CAEA 3CAEB 3CAEC 3CAED 3CAEE 3CAEF 3CAEG 3CAEH 3CAEI 3CAEJ 2PFJA 2PFJB 1M0DA 1M0DB 1M0DC 1M0DD 1FZRA 1FZRB 1FZRC 1M0IA 1M0IB 1M0IC 1M0ID 3CAEA 3CAEB 3CAEC 3CAED 3CAEE 3CAEF 3CAEG 3CAEH 3CAEI 3CAEJ 2PFJA 2PFJB
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1M0D_A;  1M0D_B;  1M0D_C;  1M0D_D;  1FZR_B;  1FZR_C;  1FZR_D;  1M0I_A;  1M0I_B;  1M0I_C;  1M0I_D;  3CAE_A;  3CAE_B;  3CAE_C;  3CAE_D;  3CAE_E;  3CAE_F;  3CAE_G;  3CAE_H;  3CAE_I;  3CAE_J;  2PFJ_A;  2PFJ_B;  1M0D_A;  1M0D_B;  1M0D_C;  1M0D_D;  1FZR_A;  1FZR_C;  1FZR_D;  1M0I_A;  1M0I_B;  1M0I_C;  1M0I_D;  3CAE_A;  3CAE_B;  3CAE_C;  3CAE_D;  3CAE_E;  3CAE_F;  3CAE_G;  3CAE_H;  3CAE_I;  3CAE_J;  2PFJ_A;  2PFJ_B;  1M0D_A;  1M0D_B;  1M0D_C;  1M0D_D;  1FZR_A;  1FZR_B;  1FZR_D;  1M0I_A;  1M0I_B;  1M0I_C;  1M0I_D;  3CAE_A;  3CAE_B;  3CAE_C;  3CAE_D;  3CAE_E;  3CAE_F;  3CAE_G;  3CAE_H;  3CAE_I;  3CAE_J;  2PFJ_A;  2PFJ_B;  1M0D_A;  1M0D_B;  1M0D_C;  1M0D_D;  1FZR_A;  1FZR_B;  1FZR_C;  1M0I_A;  1M0I_B;  1M0I_C;  1M0I_D;  3CAE_A;  3CAE_B;  3CAE_C;  3CAE_D;  3CAE_E;  3CAE_F;  3CAE_G;  3CAE_H;  3CAE_I;  3CAE_J;  2PFJ_A;  2PFJ_B; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling