1AV1ABD

Crystal structure of human apolipoprotein a-i
Link type Probability Chain A piercings Chain B piercings Chain D piercings
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
view details
6SUP3_3.2 6SUP3_3.2 41% -62B +228B -243B -61D -222A -243D +58A +50B
Interpreting sequences
Chain A Sequence
MLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Chain A Sequence
MLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Chain A Sequence
MLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
sequence length 201,201,201
structure length 201,201,201
publication title Crystal structure of truncated human apolipoprotein A-I suggests a lipid-bound conformation.
pubmed doi rcsb
molecule tags Lipid transport
molecule keywords APOLIPOPROTEIN A-I
source organism Homo sapiens
pdb deposition date1997-09-23
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
ABD PF01442 ApolipoproteinApolipoprotein A1/A4/E domain
ABD PF01442 ApolipoproteinApolipoprotein A1/A4/E domain
ABD PF01442 ApolipoproteinApolipoprotein A1/A4/E domain
Image from the rcsb pdb (www.rcsb.org)

1AV1B 1AV1C 1AV1D 6CLZB 6CLZC 6CM1B 6CM1C 6CCHA 6CCHC 6CCXA 6CCXC 6CC9A 6CC9C 2MSCA 2MSCC 2MSDA 2MSDC 2MSEA 2MSEC 4V6MA0 4V6MA1 1AV1A 1AV1C 1AV1D 6CLZB 6CLZC 6CM1B 6CM1C 6CCHA 6CCHC 6CCXA 6CCXC 6CC9A 6CC9C 2MSCA 2MSCC 2MSDA 2MSDC 2MSEA 2MSEC 4V6MA0 4V6MA1 1AV1A 1AV1B 1AV1C 6CLZB 6CLZC 6CM1B 6CM1C 6CCHA 6CCHC 6CCXA 6CCXC 6CC9A 6CC9C 2MSCA 2MSCC 2MSDA 2MSDC 2MSEA 2MSEC 4V6MA0 4V6MA1
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 1AV1_B;  1AV1_C;  1AV1_D;  6CLZ_B;  6CLZ_C;  6CM1_B;  6CM1_C;  6CCH_A;  6CCH_C;  6CCX_A;  6CCX_C;  6CC9_A;  6CC9_C;  2MSC_A;  2MSC_C;  2MSD_A;  2MSD_C;  2MSE_A;  2MSE_C;  4V6M_A0;  4V6M_A1;  1AV1_A;  1AV1_C;  1AV1_D;  6CLZ_B;  6CLZ_C;  6CM1_B;  6CM1_C;  6CCH_A;  6CCH_C;  6CCX_A;  6CCX_C;  6CC9_A;  6CC9_C;  2MSC_A;  2MSC_C;  2MSD_A;  2MSD_C;  2MSE_A;  2MSE_C;  4V6M_A0;  4V6M_A1;  1AV1_A;  1AV1_B;  1AV1_C;  6CLZ_B;  6CLZ_C;  6CM1_B;  6CM1_C;  6CCH_A;  6CCH_C;  6CCX_A;  6CCX_C;  6CC9_A;  6CC9_C;  2MSC_A;  2MSC_C;  2MSD_A;  2MSD_C;  2MSE_A;  2MSE_C;  4V6M_A0;  4V6M_A1; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling