1AATAB

Oxoglutarate-induced conformational changes in cytosolic aspartate aminotransferase
Link type Probability Chain A piercings Chain B piercings
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
view details
Unlink Unlink 56% +37B -108B +220B -413B +76A -282A
Interpreting sequences
Chain A Sequence
AASIFAAVPRAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEGQPWVLPVVRKVEQLIAGNGSLNHEYLPILGLPEFRANASRIALGDDSPAIAQKRVGSVQGLGGTGALRIGAEFLRRWYNGNNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRYWDAAKRGLDLQGLLSDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFASGNLEKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNLDYVAKSIHEAVTKIQ
Chain A Sequence
AASIFAAVPRAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEGQPWVLPVVRKVEQLIAGNGSLNHEYLPILGLPEFRANASRIALGDDSPAIAQKRVGSVQGLGGTGALRIGAEFLRRWYNGNNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRYWDAAKRGLDLQGLLSDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFASGNLEKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNLDYVAKSIHEAVTKIQ
sequence length 411,411
structure length 411,411
publication title Conformational changes in cytosol aspartate aminotransferase induced by oxoglutarate
pubmed rcsb
molecule tags Aminotransferase
molecule keywords CYTOSOLIC ASPARTATE AMINOTRANSFERASE
source organism Gallus gallus
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
ec 2.6.1.3: Cysteine transaminase.
ec 2.6.1.1: Aspartate transaminase.
ec 2.6.1.3: Cysteine transaminase.
pdb deposition date1982-04-23
LinkProt deposition date2016-08-17

pfam database annotations

chain Pfam Accession CodePfam Family IdentifierPfam Description
AB PF00155 Aminotran_1_2Aminotransferase class I and II
AB PF00155 Aminotran_1_2Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)

5TOQA 5TOQB 5TORA 5TORB 5TOTA 5TOTB 5TONA 5TONB 1AJSA 1AJSB 6DNBA 1AJRA 1AJRB 2CSTA 2CSTB 3MEBA 3MEBB 5VK7A 5VK7B 3II0A 3II0B 3II0C 3II0D 6DNDA 6DNDB 1YAAA 1YAAB 1YAAC 1YAAD 5VJZA 5VJZB 6DNAA 6DNAB 6DNAC 6DNAD 6DNAE 6DNAF 3WZFA 1AATB 5TOQA 5TOQB 5TORA 5TORB 5TOTA 5TOTB 5TONA 5TONB 1AJSA 1AJSB 6DNBA 1AJRA 1AJRB 2CSTA 2CSTB 3MEBA 3MEBB 5VK7A 5VK7B 3II0A 3II0B 3II0C 3II0D 6DNDA 6DNDB 1YAAA 1YAAB 1YAAC 1YAAD 5VJZA 5VJZB 6DNAA 6DNAB 6DNAC 6DNAD 6DNAE 6DNAF 3WZFA 1AATA
similar chains in the pdb database (40% sequence similarity)

 
            
               
               
           
#similar chains in the pdb database (40% sequence similarity)
 5TOQ_A;  5TOQ_B;  5TOR_A;  5TOR_B;  5TOT_A;  5TOT_B;  5TON_A;  5TON_B;  1AJS_A;  1AJS_B;  6DNB_A;  1AJR_A;  1AJR_B;  2CST_A;  2CST_B;  3MEB_A;  3MEB_B;  5VK7_A;  5VK7_B;  3II0_A;  3II0_B;  3II0_C;  3II0_D;  6DND_A;  6DND_B;  1YAA_A;  1YAA_B;  1YAA_C;  1YAA_D;  5VJZ_A;  5VJZ_B;  6DNA_A;  6DNA_B;  6DNA_C;  6DNA_D;  6DNA_E;  6DNA_F;  3WZF_A;  1AAT_B;  5TOQ_A;  5TOQ_B;  5TOR_A;  5TOR_B;  5TOT_A;  5TOT_B;  5TON_A;  5TON_B;  1AJS_A;  1AJS_B;  6DNB_A;  1AJR_A;  1AJR_B;  2CST_A;  2CST_B;  3MEB_A;  3MEB_B;  5VK7_A;  5VK7_B;  3II0_A;  3II0_B;  3II0_C;  3II0_D;  6DND_A;  6DND_B;  1YAA_A;  1YAA_B;  1YAA_C;  1YAA_D;  5VJZ_A;  5VJZ_B;  6DNA_A;  6DNA_B;  6DNA_C;  6DNA_D;  6DNA_E;  6DNA_F;  3WZF_A;  1AAT_A; 
           

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling