Link type | Probability | Chain B piercings | Chain G piercings | Chain P piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B | ||||||||||
view details | Hopf.2 U Ring | 17% | -14G -47P +243P -313P | -16B +103B |
Chain B Sequence |
SELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN |
Chain B Sequence |
PVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEFRDYVEERSGEDPLVKGIPEDKNPFKE |
Chain B Sequence |
FEGQASHTGPKGVINDWRKFKLESE------------------------------FSRKMSVQEYELIHKDKEDENCLRKYRRQCMQDMHQKLSFGPRYGFVYELESGEQFLETIEKEQKITTIVVHIYEDGIKGCDALNSSLICLAAEYPMVKFCKIKASNTGAGDRFSSDVLPTLLVYKGGELLSNFISVTEQLAEEFFTGDVESFLNEYGLLPEK |
sequence length | 339,65,218 |
structure length | 339,65,188 |
publication title |
Phosducin induces a structural change in transducin beta gamma.
pubmed doi rcsb |
molecule tags | Complex (transducer/transduction) |
molecule keywords | TRANSDUCIN (BETA SUBUNIT) |
missing residues | P: 37-68 |
pdb deposition date | 1997-12-05 |
LinkProt deposition date | 2016-08-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
BGP | PF00400 | WD40 | WD domain, G-beta repeat |
BGP | PF00631 | G-gamma | GGL domain |
BGP | PF02114 | Phosducin | Phosducin |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | 7 Propellor | Methylamine Dehydrogenase; Chain H | YVTN repeat-like/Quinoprotein amine dehydrogenase | ||
Few Secondary Struct | Irregular | G Protein Gi Gamma 2 | Transducin (heterotrimeric G protein), gamma chain | ||
Mainly Alpha | Orthogonal Bundle | Phosducin; domain 2 | Phosducin, domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Glutaredoxin | Glutaredoxin |
#chains in the LinkProt database with same CATH superfamily 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BG; 1A0R BP; 3DIE AB; #chains in the LinkProt database with same CATH topology 3HXS AB; 1OC3 AC; 3FCS AC; 1A0R BG; 3FCS ABC; 3FCS ABD; 3FCS CD; 3FCS AD; 1A0R BGP; 1OC3 BC; 3FCS AB; 3FCS ACD; 1QQ2 AB; 3FCS BCD; 1OC3 ABC; 1A0R BP; 3FCS BC; 3DIE AB; #chains in the LinkProt database with same CATH homology 3HXS AB; 1OC3 ABC; 1OC3 AC; 1A0R BGP; 1OC3 BC; 1QQ2 AB; 1A0R BG; 1A0R BP; 3DIE AB;
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...