6O9HACDH

Mouse ecd with fab1
A: 131-140 H: 133-140
Link type Probability Loop ranges Chain A piercings Chain C piercings Chain D piercings Chain H piercings
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
view details
Other Other 32% -A +30C +77C +219D +219D +94H +219A -219H
Interpreting sequences
Chain A Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGKYPTWIAYWGQGTLVTVSAAKTTPPSVYPLAP--------MVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Chain A Sequence
GELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPE
Chain A Sequence
GELYQRWEHYGQECQKMLETTEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWFRQVSAGFVFRQCGSDGQWGSWRDHTQCENPE
Chain A Sequence
DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGKYPTWIAYWGQGTLVTVSAAKTTPPSVYPLAPGS------MVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
sequence length 218,90,90,219
structure length 210,90,90,213
publication title Molecular mechanism of an antagonistic antibody against glucose-dependent insulinotropic polypeptide receptor.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Heavy chain
source organism Homo sapiens
missing residues A: 131-140 H: 133-140
pdb deposition date2019-03-13
LinkProt deposition date2020-01-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling