6NMYDFJM

A cytokine-receptor complex
M: 45-49,89-93
Link type Probability Loop ranges Chain D piercings Chain F piercings Chain J piercings Chain M piercings
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
view details
Other Other 35% -D -248F -437J +120M +437D +27D -41D -87M
Interpreting sequences
Chain D Sequence
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLQVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTE
Chain D Sequence
PITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQ
Chain D Sequence
YVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLEN
Chain D Sequence
TNLRMKAKAQQLTWDLNR---DIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPP---WILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQ
sequence length 197,270,108,268
structure length 197,270,108,262
publication title Signalling conformation of cell surface receptor
rcsb
molecule tags Cytokine
molecule keywords Interleukin-3 receptor subunit alpha
source organism Homo sapiens
missing residues M: 45-49,89-93
pdb deposition date2019-01-13
LinkProt deposition date2020-01-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling