6NMYCFIJ

A cytokine-receptor complex
Link type Probability Loop ranges Chain C piercings Chain F piercings Chain I piercings Chain J piercings
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
view details
Other Other 35% -C -296F -240I
Interpreting sequences
Chain C Sequence
EETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQP
Chain C Sequence
PITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQ
Chain C Sequence
YVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLEN
Chain C Sequence
YVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLEN
sequence length 215,270,108,108
structure length 215,270,108,108
publication title Signalling conformation of cell surface receptor
rcsb
molecule tags Cytokine
molecule keywords Interleukin-3 receptor subunit alpha
source organism Homo sapiens
pdb deposition date2019-01-13
LinkProt deposition date2020-01-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling