6NMYBIJM

A cytokine-receptor complex
M: 45-49,89-93
Link type Probability Loop ranges Chain B piercings Chain I piercings Chain J piercings Chain M piercings
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
view details
Other Other 30% -B -121M +243B -328B -437B
Interpreting sequences
Chain B Sequence
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLQVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDT
Chain B Sequence
YVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLEN
Chain B Sequence
YVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLEN
Chain B Sequence
TNLRMKAKAQQLTWDLNR---DIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPP---WILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQ
sequence length 196,108,108,268
structure length 196,108,108,262
publication title Signalling conformation of cell surface receptor
rcsb
molecule tags Cytokine
molecule keywords Interleukin-3 receptor subunit alpha
source organism Homo sapiens
missing residues M: 45-49,89-93
pdb deposition date2019-01-13
LinkProt deposition date2020-01-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...

...loading similar chains in PDB, please wait...


 
#similar chains in the LinkProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unlinked
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

LinkProt | Interdisciplinary Laboratory of Biological Systems Modelling