Link type | Probability | Loop ranges | Chain A piercings | Chain F piercings | Chain J piercings | Chain M piercings | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M | |||||||||
view details |
![]() |
Other | 43% | -A | -75M -107M | -239A -239A | -84A +94A -295M |
Chain A Sequence |
EETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQP |
Chain A Sequence |
PITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQ |
Chain A Sequence |
YVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLEN |
Chain A Sequence |
TNLRMKAKAQQLTWDLNR---DIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPP---WILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQ |
sequence length | 215,270,108,268 |
structure length | 215,270,108,262 |
publication title |
Signalling conformation of cell surface receptor
rcsb |
molecule tags | Cytokine |
molecule keywords | Interleukin-3 receptor subunit alpha |
source organism | Homo sapiens |
missing residues | M: 45-49,89-93 |
pdb deposition date | 2019-01-13 |
LinkProt deposition date | 2020-01-26 |
#similar chains in the LinkProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unlinked ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...